2ZYA - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   DIMERIC 6-PHOSPHOGLUCONATE DEHYDROGENASE COMPLEXED WITH 6-PHOSPHOGLUCONATE

Authors :   Y. -Y. Chen, T. -P. Ko, L. -P. Lo, C. -H. Lin, A. H. -J. Wang

Date :   19 Jan 09 (Deposition) - 01 Sep 09 (Release) - 22 Jan 14 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.60

Chains :   Asym./Biol. Unit : A,B

Keywords :   Nadp, Pentose Phosphate Pathway, Oxidoreductase, 6-Phosphogluconate Dehydrogenase, 6-Phosphogluconate, Gluconate Utilization, Pentose Shunt (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. -Y. Chen, T. -P. Ko, W. -H. Chen, L. -P. Lo, C. -H. Lin, A. H. -J. Wang
Conformational Changes Associated With Cofactor/Substrate Binding Of 6-Phosphogluconate Dehydrogenase From Escherichi Coli And Klebsiella Pneumoniae: Implications For Enzyme Mechanism
J. Struct. Biol. V. 169 25 2010
PubMed-ID: 19686854 | Reference-DOI: 10.1016/J.JSB.2009.08.006

Molecule 1 - 6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
	Chains	:	A, B
	EC Number	:	1.1.1.44
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PET16B
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	GND
	Mutation	:	YES
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	83333
	Other Details	:	SPECIFIC MUTATION Y378C
	Strain	:	K-12

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 2)

No.	Name	Count	Type	Full Name
1	6PG	2	Ligand/Ion	6-PHOSPHOGLUCONIC ACID

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASN A:102 , SER A:128 , GLY A:129 , GLY A:130 , LYS A:183 , HIS A:186 , ASN A:187 , GLU A:190 , TYR A:191 , ASN A:259 , LYS A:260 , ARG A:287 , ILE A:365 , HOH A:656 , HOH A:657 , HOH A:714 , HOH A:946 , ARG B:445 , PHE B:448 , HIS B:451	BINDING SITE FOR RESIDUE 6PG A2002
2	AC2	SOFTWARE	ARG A:445 , PHE A:448 , HIS A:451 , ASN B:102 , SER B:128 , GLY B:129 , GLY B:130 , LYS B:183 , HIS B:186 , ASN B:187 , GLU B:190 , TYR B:191 , LYS B:260 , ARG B:287 , ILE B:365 , HOH B:661 , HOH B:839 , HOH B:915 , HOH B:928 , HOH B:1264	BINDING SITE FOR RESIDUE 6PG B2001

(no "SS Bond" information available for 2ZYA)

Asymmetric/Biological Unit

No.	Residues
1	Thr A:66	-	Pro A:67
2	Thr B:66	-	Pro B:67

Asymmetric/Biological Unit (21, 42)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_6PGD_ECOLI_001 *	S	2	L	6PGD_ECOLI	---	---	A/B	S	2	L
02	UniProt	VAR_6PGD_ECOLI_002 *	F	32	Y	6PGD_ECOLI	---	---	A/B	F	32	Y
03	UniProt	VAR_6PGD_ECOLI_003 *	T	39	Q	6PGD_ECOLI	---	---	A/B	T	39	Q
04	UniProt	VAR_6PGD_ECOLI_004 *	V	52	D	6PGD_ECOLI	---	---	A/B	V	52	D
05	UniProt	VAR_6PGD_ECOLI_005 *	Y	55	F	6PGD_ECOLI	---	---	A/B	Y	55	F
06	UniProt	VAR_6PGD_ECOLI_006 *	N	102	K	6PGD_ECOLI	---	---	A/B	N	102	K
07	UniProt	VAR_6PGD_ECOLI_007 *	A	117	S	6PGD_ECOLI	---	---	A/B	A	117	S
08	UniProt	VAR_6PGD_ECOLI_008 *	V	170	F	6PGD_ECOLI	---	---	A/B	V	170	F
09	UniProt	VAR_6PGD_ECOLI_009 *	A	175	S	6PGD_ECOLI	---	---	A/B	A	175	S
10	UniProt	VAR_6PGD_ECOLI_010 *	N	209	S	6PGD_ECOLI	---	---	A/B	N	209	S
11	UniProt	VAR_6PGD_ECOLI_011 *	T	211	S	6PGD_ECOLI	---	---	A/B	T	211	S
12	UniProt	VAR_6PGD_ECOLI_012 *	A	216	T	6PGD_ECOLI	---	---	A/B	A	216	T
13	UniProt	VAR_6PGD_ECOLI_013 *	D	294	E	6PGD_ECOLI	---	---	A/B	D	294	E
14	UniProt	VAR_6PGD_ECOLI_014 *	A	308	G	6PGD_ECOLI	---	---	A/B	A	308	G
15	UniProt	VAR_6PGD_ECOLI_015 *	D	313	N	6PGD_ECOLI	---	---	A/B	D	313	N
16	UniProt	VAR_6PGD_ECOLI_016 *	A	315	G	6PGD_ECOLI	---	---	A/B	A	315	G
17	UniProt	VAR_6PGD_ECOLI_017 *	L	325	Q	6PGD_ECOLI	---	---	A/B	L	325	Q
18	UniProt	VAR_6PGD_ECOLI_018 *	I	330	S	6PGD_ECOLI	---	---	A/B	I	330	S
19	UniProt	VAR_6PGD_ECOLI_019 *	D	350	A	6PGD_ECOLI	---	---	A/B	D	350	A
20	UniProt	VAR_6PGD_ECOLI_020 *	Q	369	R	6PGD_ECOLI	---	---	A/B	Q	369	R
21	UniProt	VAR_6PGD_ECOLI_021 *	S	422	A	6PGD_ECOLI	---	---	A/B	S	422	A
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	6PGD	PS00461	6-phosphogluconate dehydrogenase signature.	6PGD_ECOLI	253-265	2	A:253-265 B:253-265

(no "Exon" information available for 2ZYA)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:465
 aligned with 6PGD_ECOLI | P00350 from UniProtKB/Swiss-Prot  Length:468

    Alignment length:465
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461     
           6PGD_ECOLI     2 SKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDAYAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEW 466
               SCOP domains d2zyaa1 A:2-176 automated matches                                                                                                                                              d2zyaa2 A:177-466 automated matches                                                                                                                                                                                                                                                                SCOP domains
               CATH domains 2zyaA01 A:2-180 NAD(P)-binding Rossmann-like Domain                                                                                                                                2zyaA02 A:181-434 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2                                                                                                                                                                                   2zyaA03 A:435-466                CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eee..hhhhhhhhhhhhhh...eeee..hhhhhhhhhhhh....eee..hhhhhhhh.....eeee....hhhhhhhhhhhhhhh....eeee....hhhhhhhhhhhhhhh..eeeeeeeehhhhhhhhh.eeeee.hhhhhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh...hhhhhhhhhhh........hhhhhh.......hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhh........hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh....hhhhhhhhhhhhhh..ee......ee.... Sec.struct. author
                 SAPs(SNPs) L-----------------------------Y------Q------------D--F----------------------------------------------K--------------S----------------------------------------------------F----S---------------------------------S-S----T-----------------------------------------------------------------------------E-------------G----N-G---------Q----S-------------------A------------------R----------------------------------------------------A-------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------6PGD         --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zya A   2 SKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDACAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEW 466
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461

Chain B from PDB  Type:PROTEIN  Length:466
 aligned with 6PGD_ECOLI | P00350 from UniProtKB/Swiss-Prot  Length:468

    Alignment length:466
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461      
           6PGD_ECOLI     2 SKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDAYAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEWL 467
               SCOP domains d2zyab1 B:2-176 automated matches                                                                                                                                              d2zyab2 B:177-467 automated matches                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains 2zyaB01 B:2-180 NAD(P)-binding Rossmann-like Domain                                                                                                                                2zyaB02 B:181-434 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2                                                                                                                                                                                   2zyaB03 B:435-467                 CATH domains
           Pfam domains (1) -NAD_binding_2-2zyaB03 B:3-175                                                                                                                                                ---6PGD-2zyaB01 B:179-467                                                                                                                                                                                                                                                                            Pfam domains (1)
           Pfam domains (2) -NAD_binding_2-2zyaB04 B:3-175                                                                                                                                                ---6PGD-2zyaB02 B:179-467                                                                                                                                                                                                                                                                            Pfam domains (2)
         Sec.struct. author ....eeee..hhhhhhhhhhhhhh...eeee..hhhhhhhhhhhh....eee..hhhhhhhh.....eeee....hhhhhhhhhhhhhhh....eeee....hhhhhhhhhhhhhhh..eeeeeeeehhhhhhhhh.eeeeeehhhhhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh....hhhhhhhhhhh........hhhhhh.......hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhh........hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh....hhhhhhhhhhhhhh..ee......ee..... Sec.struct. author
                 SAPs(SNPs) L-----------------------------Y------Q------------D--F----------------------------------------------K--------------S----------------------------------------------------F----S---------------------------------S-S----T-----------------------------------------------------------------------------E-------------G----N-G---------Q----S-------------------A------------------R----------------------------------------------------A--------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------6PGD         ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zya B   2 SKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDACAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEWL 467
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: 6PGD_C (47)

Family: 6PGD (10)

Escherichia coli (strain K12) (2)

1a	6PGD-2zyaB01	B:179-467
1b	6PGD-2zyaB02	B:179-467

Clan: NADP_Rossmann (1239)

Family: NAD_binding_2 (15)

Escherichia coli (strain K12) (2)

2a	NAD_binding_2-2zyaB03	B:3-175
2b	NAD_binding_2-2zyaB04	B:3-175

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (6PGD_ECOLI | P00350)

molecular function
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0004616	phosphogluconate dehydrogenase (decarboxylating) activity	Catalysis of the reaction: 6-phospho-D-gluconate + NADP+ = D-ribulose 5-phosphate + CO2 + NADPH + H+.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
	GO:0019521	D-gluconate metabolic process	The chemical reactions and pathways involving D-gluconate, the anion of D-gluconic acid, the aldonic acid derived from glucose.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0006098	pentose-phosphate shunt	The glucose-6-phosphate catabolic process in which, coupled to NADPH synthesis, glucose-6-P is oxidized with the formation of carbon dioxide (CO2) and ribulose 5-phosphate; ribulose 5-P then enters a series of reactions interconverting sugar phosphates. The pentose phosphate pathway is a major source of reducing equivalents for biosynthesis reactions and is also important for the conversion of hexoses to pentoses.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		6PG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Thr A:66 - Pro A:67	[ RasMol ]
		Thr B:66 - Pro B:67	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2zya
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	6PGD_ECOLI \| P00350
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.1.1.44
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	6PGD_ECOLI \| P00350
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	6PGD_ECOLI \| P00350	:	2zyd 3fwn

2zyd	RELATED ENTRY DESCRIPTION MODEL FOR MOLECULAR REPLACEMENT
2zyg
3fwn

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (21, 42)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (3, 6)

Pfam Domains (2, 4)

Gene Ontology (8, 8)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File