2Z3R - JenaLib

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:113
 aligned with IL15_HUMAN | P40933 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:151
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159 
           IL15_HUMAN    10 SISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFIN 160
               SCOP domains d2z3r                                  a_ A: Interleukin-15 (IL-15)                                                                                     SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....h----------------------------------hhhhhhhhhhhhhhhhh.......eee....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh----......hhhhheeehhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.6a  PDB: A:-4-0      ----------------------------Exon 1.9       Exon 1.10  PDB: A:33-76 UniProt: 81-126       Exon 1.11c  PDB: A:81-112          Transcript 1 (1)
           Transcript 1 (2) ---------------------------Exon 1.8b  PDB: A:1-17       ----------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2z3r A  -4 AMAIS----------------------------------NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSS----TESGCKECEELEEKNIKEFLQSFVHIVQMFIN 112
                                |    -         -         -         1        11        21        31        41        51        61        71    |   81        91       101       111 
                                0                                  1                                                                         76   81

Chain B from PDB  Type:PROTEIN  Length:74
 aligned with I15RA_HUMAN | Q13261 from UniProtKB/Swiss-Prot  Length:267

    Alignment length:74
                                    39        49        59        69        79        89        99    
          I15RA_HUMAN    30 GITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQR 103
               SCOP domains d2z3rb_ B: Interleukin-15 receptor subunit alpha                           SCOP domains
               CATH domains -------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............ee..........eee.ee...eee......eeeeee.hhhh.eee......eeehhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -SUSHI  PDB: B:1-65 UniProt: 31-95                                -------- PROSITE
           Transcript 2 (1) 2----------------------------------------------------------------Exon 2.5a Transcript 2 (1)
           Transcript 2 (2) Exon 2.4  PDB: B:0-65 UniProt: 30-95                              -------- Transcript 2 (2)
                 2z3r B   0 SITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQR  73
                                     9        19        29        39        49        59        69

Chain C from PDB  Type:PROTEIN  Length:116
 aligned with IL15_HUMAN | P40933 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:153
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159   
           IL15_HUMAN    10 SISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS 162
               SCOP domains d2z3r                                  c_ C: Interleukin-15 (IL-15)                                                                                       SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh----------------------------------hhhhhhhhhhhhhhhh........eee....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.---.......hhhhheeehhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.6a  PDB: C:-4-0      ----------------------------Exon 1.9       Exon 1.10  PDB: C:33-76 UniProt: 81-126       Exon 1.11c  PDB: C:80-114            Transcript 1 (1)
           Transcript 1 (2) ---------------------------Exon 1.8b  PDB: C:1-17       ------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2z3r C  -4 AMAIS----------------------------------NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSS---VTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS 114
                                |    -         -         -         1        11        21        31        41        51        61        71    |   81        91       101       111   
                                0                                  1                                                                         76  80

Chain D from PDB  Type:PROTEIN  Length:76
 aligned with I15RA_HUMAN | Q13261 from UniProtKB/Swiss-Prot  Length:267

    Alignment length:102
                                    10        20        30        40        50        60        70        80        90       100  
          I15RA_HUMAN     1 MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQ 102
               SCOP domains d2z3                          rd_ D: Interleukin-15 receptor subunit alpha                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....--------------------------...........eee.........eeeeee...eee......eeeeee......eee......eee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------SUSHI  PDB: D:1-65 UniProt: 31-95                                ------- PROSITE
           Transcript 2 (1) Exon 2.2a  PDB: D:-3-0        ----------------------------------------------------------------2.5a     Transcript 2 (1)
           Transcript 2 (2) -----------------------------Exon 2.4  PDB: D:1-65 UniProt: 30-95 [INCOMPLETE]                 ------- Transcript 2 (2)
                 2z3r D  -3 MAIS--------------------------ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQ  72
                               |     -         -         -|       10        20        30        40        50        60        70  
                               0                          1

Chain E from PDB  Type:PROTEIN  Length:119
 aligned with IL15_HUMAN | P40933 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:153
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159   
           IL15_HUMAN    10 SISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS 162
               SCOP domains d2z3r                                  e_ E: Interleukin-15 (IL-15)                                                                                       SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhh----------------------------------hhhhhhhhhhhhhhhhh......eeee....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhheeeehhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.6a  PDB: E:-4-0      ----------------------------Exon 1.9       Exon 1.10  PDB: E:33-78 UniProt: 81-126       Exon 1.11c  PDB: E:79-114            Transcript 1 (1)
           Transcript 1 (2) ---------------------------Exon 1.8b  PDB: E:1-17       ------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2z3r E  -4 AMAIS----------------------------------NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS 114
                                |    -         -         -         1        11        21        31        41        51        61        71        81        91       101       111   
                                0                                  1

Chain F from PDB  Type:PROTEIN  Length:73
 aligned with I15RA_HUMAN | Q13261 from UniProtKB/Swiss-Prot  Length:267

    Alignment length:73
                                    39        49        59        69        79        89        99   
          I15RA_HUMAN    30 GITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQ 102
               SCOP domains d2z3rf_ F: Interleukin-15 receptor subunit alpha                          SCOP domains
               CATH domains ------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............eee.........eeeeee...eee......eeeeee.hhhh.eee......eeehhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -SUSHI  PDB: F:1-65 UniProt: 31-95                                ------- PROSITE
           Transcript 2 (1) 2----------------------------------------------------------------2.5a     Transcript 2 (1)
           Transcript 2 (2) Exon 2.4  PDB: F:0-65 UniProt: 30-95                              ------- Transcript 2 (2)
                 2z3r F   0 SITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQ  72
                                     9        19        29        39        49        59        69

Chain G from PDB  Type:PROTEIN  Length:119
 aligned with IL15_HUMAN | P40933 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:153
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159   
           IL15_HUMAN    10 SISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS 162
               SCOP domains d2z3r                                  g_ G: Interleukin-15 (IL-15)                                                                                       SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....h----------------------------------hhhhhhhhhhhhhhhhh.......eee....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhheeehhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.6a  PDB: G:-4-0      ----------------------------Exon 1.9       Exon 1.10  PDB: G:33-78 UniProt: 81-126       Exon 1.11c  PDB: G:79-114            Transcript 1 (1)
           Transcript 1 (2) ---------------------------Exon 1.8b  PDB: G:1-17       ------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2z3r G  -4 AMAIS----------------------------------NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS 114
                                |    -         -         -         1        11        21        31        41        51        61        71        81        91       101       111   
                                0                                  1

Chain H from PDB  Type:PROTEIN  Length:77
 aligned with I15RA_HUMAN | Q13261 from UniProtKB/Swiss-Prot  Length:267

    Alignment length:77
                                    35        45        55        65        75        85        95       
          I15RA_HUMAN    26 PATRGITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQ 102
               SCOP domains d2z3rh_ H: Interleukin-15 receptor subunit alpha                              SCOP domains
               CATH domains ----------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................ee..........eee.ee...eee......eeeeee......eee......eeehhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----SUSHI  PDB: H:1-65 UniProt: 31-95                                ------- PROSITE
           Transcript 2 (1) 2.2a ----------------------------------------------------------------2.5a     Transcript 2 (1)
           Transcript 2 (2) ----Exon 2.4  PDB: H:0-65 UniProt: 30-95                              ------- Transcript 2 (2)
                 2z3r H  -4 AMAISITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQ  72
                                     5        15        25        35        45        55        65

Chain I from PDB  Type:PROTEIN  Length:116
 aligned with IL15_HUMAN | P40933 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:153
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159   
           IL15_HUMAN    10 SISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS 162
               SCOP domains d2z3r                                  i_ I: Interleukin-15 (IL-15)                                                                                       SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....h----------------------------------hhhhhhhhhhhhhhhhh.......ee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.---.......hhhhh.eehhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.6a  PDB: I:-4-0      ----------------------------Exon 1.9       Exon 1.10  PDB: I:33-76 UniProt: 81-126       Exon 1.11c  PDB: I:80-114            Transcript 1 (1)
           Transcript 1 (2) ---------------------------Exon 1.8b  PDB: I:1-17       ------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2z3r I  -4 AMAIS----------------------------------NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSS---VTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS 114
                                |    -         -         -         1        11        21        31        41        51        61        71    |   81        91       101       111   
                                0                                  1                                                                         76  80

Chain J from PDB  Type:PROTEIN  Length:78
 aligned with I15RA_HUMAN | Q13261 from UniProtKB/Swiss-Prot  Length:267

    Alignment length:78
                                    35        45        55        65        75        85        95        
          I15RA_HUMAN    26 PATRGITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQR 103
               SCOP domains d2z3rj_ J: Interleukin-15 receptor subunit alpha                               SCOP domains
               CATH domains ------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ................ee..........eee.ee...eee......eeeeee......eee......eeehhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -----SUSHI  PDB: J:1-65 UniProt: 31-95                                -------- PROSITE
           Transcript 2 (1) 2.2a ----------------------------------------------------------------Exon 2.5a Transcript 2 (1)
           Transcript 2 (2) ----Exon 2.4  PDB: J:0-65 UniProt: 30-95                              -------- Transcript 2 (2)
                 2z3r J  -4 AMAISITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQR  73
                                     5        15        25        35        45        55        65

Chain K from PDB  Type:PROTEIN  Length:116
 aligned with IL15_HUMAN | P40933 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:153
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159   
           IL15_HUMAN    10 SISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS 162
               SCOP domains d2z3r                                  k_ K: Interleukin-15 (IL-15)                                                                                       SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhh----------------------------------hhhhhhhhhhhhhhhh.......eee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh---.......hhhhh.eeehhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.6a  PDB: K:-4-0      ----------------------------Exon 1.9       Exon 1.10  PDB: K:33-76 UniProt: 81-126       Exon 1.11c  PDB: K:80-114            Transcript 1 (1)
           Transcript 1 (2) ---------------------------Exon 1.8b  PDB: K:1-17       ------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2z3r K  -4 AMAIS----------------------------------NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSS---VTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS 114
                                |    -         -         -         1        11        21        31        41        51        61        71    |   81        91       101       111   
                                0                                  1                                                                         76  80

Chain L from PDB  Type:PROTEIN  Length:75
 aligned with I15RA_HUMAN | Q13261 from UniProtKB/Swiss-Prot  Length:267

    Alignment length:75
                                    38        48        58        68        78        88        98     
          I15RA_HUMAN    29 RGITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQR 103
               SCOP domains d2z3rl_ L: Interleukin-15 receptor subunit alpha                            SCOP domains
               CATH domains --------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............ee..........eee.ee...eee......eeeeeee....eeee......eeehhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --SUSHI  PDB: L:1-65 UniProt: 31-95                                -------- PROSITE
           Transcript 2 (1) 2.----------------------------------------------------------------Exon 2.5a Transcript 2 (1)
           Transcript 2 (2) -Exon 2.4  PDB: L:0-65 UniProt: 30-95                              -------- Transcript 2 (2)
                 2z3r L  -1 ISITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQR  73
                                     8        18        28        38        48        58        68

Chain M from PDB  Type:PROTEIN  Length:116
 aligned with IL15_HUMAN | P40933 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:153
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159   
           IL15_HUMAN    10 SISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS 162
               SCOP domains d2z3r                                  m_ M: Interleukin-15 (IL-15)                                                                                       SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh----------------------------------hhhhhhhhhhhhhhhhh.......ee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.---.......hhhhh.eehhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.6a  PDB: M:-4-0      ----------------------------Exon 1.9       Exon 1.10  PDB: M:33-76 UniProt: 81-126       Exon 1.11c  PDB: M:80-114            Transcript 1 (1)
           Transcript 1 (2) ---------------------------Exon 1.8b  PDB: M:1-17       ------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2z3r M  -4 AMAIS----------------------------------NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSS---VTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS 114
                                |    -         -         -         1        11        21        31        41        51        61        71    |   81        91       101       111   
                                0                                  1                                                                         76  80

Chain N from PDB  Type:PROTEIN  Length:76
 aligned with I15RA_HUMAN | Q13261 from UniProtKB/Swiss-Prot  Length:267

    Alignment length:102
                                    10        20        30        40        50        60        70        80        90       100  
          I15RA_HUMAN     1 MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQ 102
               SCOP domains d2z3                          rn_ N: Interleukin-15 receptor subunit alpha                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....--------------------------...........ee..........eee.ee...eee......eeeeeee....eeee......eee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------SUSHI  PDB: N:1-65 UniProt: 31-95                                ------- PROSITE
           Transcript 2 (1) Exon 2.2a  PDB: N:-3-0        ----------------------------------------------------------------2.5a     Transcript 2 (1)
           Transcript 2 (2) -----------------------------Exon 2.4  PDB: N:1-65 UniProt: 30-95 [INCOMPLETE]                 ------- Transcript 2 (2)
                 2z3r N  -3 MAIS--------------------------ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQ  72
                               |     -         -         -|       10        20        30        40        50        60        70  
                               0                          1

Chain O from PDB  Type:PROTEIN  Length:118
 aligned with IL15_HUMAN | P40933 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:152
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159  
           IL15_HUMAN    10 SISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINT 161
               SCOP domains d2z3r                                  o_ O: Interleukin-15 (IL-15)                                                                                      SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ---------------------------------------IL15-2z3rO01 O:1-112                                                                                            - Pfam domains (1)
           Pfam domains (2) ---------------------------------------IL15-2z3rO02 O:1-112                                                                                            - Pfam domains (2)
           Pfam domains (3) ---------------------------------------IL15-2z3rO03 O:1-112                                                                                            - Pfam domains (3)
           Pfam domains (4) ---------------------------------------IL15-2z3rO04 O:1-112                                                                                            - Pfam domains (4)
           Pfam domains (5) ---------------------------------------IL15-2z3rO05 O:1-112                                                                                            - Pfam domains (5)
           Pfam domains (6) ---------------------------------------IL15-2z3rO06 O:1-112                                                                                            - Pfam domains (6)
           Pfam domains (7) ---------------------------------------IL15-2z3rO07 O:1-112                                                                                            - Pfam domains (7)
           Pfam domains (8) ---------------------------------------IL15-2z3rO08 O:1-112                                                                                            - Pfam domains (8)
         Sec.struct. author ....h----------------------------------hhhhhhhhhhhhhhhh........eee....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhheeehhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.6a  PDB: O:-4-0      ----------------------------Exon 1.9       Exon 1.10  PDB: O:33-78 UniProt: 81-126       Exon 1.11c  PDB: O:79-113           Transcript 1 (1)
           Transcript 1 (2) ---------------------------Exon 1.8b  PDB: O:1-17       ------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 2z3r O  -4 AMAIS----------------------------------NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINT 113
                                |    -         -         -         1        11        21        31        41        51        61        71        81        91       101       111  
                                0                                  1

Chain P from PDB  Type:PROTEIN  Length:72
 aligned with I15RA_HUMAN | Q13261 from UniProtKB/Swiss-Prot  Length:267

    Alignment length:72
                                    39        49        59        69        79        89        99  
          I15RA_HUMAN    30 GITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVH 101
               SCOP domains d2z3rp_ P: Interleukin-15 receptor subunit alpha                         SCOP domains
               CATH domains ------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ............eee.........eeeeee...eee......eeeeee......eee......eeehhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -SUSHI  PDB: P:1-65 UniProt: 31-95                                ------ PROSITE
           Transcript 2 (1) 2----------------------------------------------------------------2.5a    Transcript 2 (1)
           Transcript 2 (2) Exon 2.4  PDB: P:0-65 UniProt: 30-95                              ------ Transcript 2 (2)
                 2z3r P   0 SITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVH  71
                                     9        19        29        39        49        59        69

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit(hide GO term definitions)

Chain A,C,E,G,I,K,M,O (IL15_HUMAN | P40933)

molecular function
	GO:0005125	cytokine activity	Functions to control the survival, growth, differentiation and effector function of tissues and cells.
	GO:0005126	cytokine receptor binding	Interacting selectively and non-covalently with a cytokine receptor.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0001866	NK T cell proliferation	The expansion of a NK T cell population by cell division.
	GO:0007568	aging	A developmental process that is a deterioration and loss of function over time. Aging includes loss of functions such as resistance to disease, homeostasis, and fertility, as well as wear and tear. Aging includes cellular senescence, but is more inclusive. May precede death and may succeed developmental maturation (GO:0021700).
	GO:0048469	cell maturation	A developmental process, independent of morphogenetic (shape) change, that is required for a cell to attain its fully functional state.
	GO:0007267	cell-cell signaling	Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
	GO:0071305	cellular response to vitamin D	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a vitamin D stimulus.
	GO:0045062	extrathymic T cell selection	The process of T cell selection that occurs in extrathymic locations, often resulting T cells of distinct specificities from those selected in the thymus.
	GO:0030212	hyaluronan metabolic process	The chemical reactions and pathways involving hyaluronan, the naturally occurring anionic form of hyaluronic acid, any member of a group of glycosaminoglycans, the repeat units of which consist of beta-1,4 linked D-glucuronyl-beta-(1,3)-N-acetyl-D-glucosamine.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0006954	inflammatory response	The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
	GO:0048535	lymph node development	The process whose specific outcome is the progression of lymph nodes over time, from their formation to the mature structure. A lymph node is a round, oval, or bean shaped structure localized in clusters along the lymphatic vessels, with a distinct internal structure including specialized vasculature and B- and T-zones for the activation of lymphocytes.
	GO:0001779	natural killer cell differentiation	The process in which a relatively unspecialized cell acquires the specialized features of a natural killer cell.
	GO:0048662	negative regulation of smooth muscle cell proliferation	Any process that stops, prevents or reduces the rate or extent of smooth muscle cell proliferation.
	GO:0042102	positive regulation of T cell proliferation	Any process that activates or increases the rate or extent of T cell proliferation.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0050778	positive regulation of immune response	Any process that activates or increases the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus.
	GO:0050729	positive regulation of inflammatory response	Any process that activates or increases the frequency, rate or extent of the inflammatory response.
	GO:0032740	positive regulation of interleukin-17 production	Any process that activates or increases the frequency, rate, or extent of production of any member of the interleukin-17 family of cytokines.
	GO:0032825	positive regulation of natural killer cell differentiation	Any process that activates or increases the frequency, rate or extent of natural killer cell differentiation.
	GO:0032819	positive regulation of natural killer cell proliferation	Any process that activates or increases the frequency, rate or extent of natural killer cell proliferation.
	GO:1904100	positive regulation of protein O-linked glycosylation	Any process that activates or increases the frequency, rate or extent of protein O-linked glycosylation.
	GO:0034105	positive regulation of tissue remodeling	Any process that activates or increases the frequency, rate, or extent of tissue remodeling.
	GO:0045580	regulation of T cell differentiation	Any process that modulates the frequency, rate or extent of T cell differentiation.
	GO:0050691	regulation of defense response to virus by host	Any host process that modulates the frequency, rate, or extent of the antiviral response of a host cell or organism.
	GO:0031667	response to nutrient levels	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus reflecting the presence, absence, or concentration of nutrients.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0014732	skeletal muscle atrophy	A process, occurring in skeletal muscle, that is characterized by a decrease in protein content, fiber diameter, force production and fatigue resistance in response to different conditions such as starvation, aging and disuse.
cellular component
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B,D,F,H,J,L,N,P (I15RA_HUMAN | Q13261)

molecular function
	GO:0004896	cytokine receptor activity	Combining with a cytokine and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004871	signal transducer activity	Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
biological process
	GO:0008283	cell proliferation	The multiplication or reproduction of cells, resulting in the expansion of a cell population.
	GO:0019221	cytokine-mediated signaling pathway	A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0000139	Golgi membrane	The lipid bilayer surrounding any of the compartments of the Golgi apparatus.
	GO:0031410	cytoplasmic vesicle	A vesicle found in the cytoplasm of a cell.
	GO:0030659	cytoplasmic vesicle membrane	The lipid bilayer surrounding a cytoplasmic vesicle.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0031965	nuclear membrane	Either of the lipid bilayers that surround the nucleus and form the nuclear envelope; excludes the intermembrane space.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 4)

Sites (0, 0)

SS Bonds (32, 32)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 8)

Exons (8, 64)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 16)

CATH Domains (0, 0)

Pfam Domains (1, 8)

Gene Ontology (51, 58)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File