Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE N-TERMINAL DOMAIN OF THE SHIGELLA TYPE III SECRETION PROTEIN MXIG
 
Authors :  M. A. Mcdowell, S. Johnson, J. E. Deane, J. M. Mcdonnell, S. M. Lea
Date :  11 Nov 10  (Deposition) - 06 Jul 11  (Release) - 07 Sep 11  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Pathogenesis, Transport, Protein Binding, Virulence, Basal Body Structural Component (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. A. Mcdowell, S. Johnson, J. E. Deane, M. Cheung, A. D. Roehrich, A. J. Blocker, J. M. Mcdonnell, S. M. Lea
Structural And Functional Studies On The N- Terminal Domain Of The Shigella Type Iii Secretion Protein Mxig.
J. Biol. Chem. V. 286 30606 2011
PubMed-ID: 21733840  |  Reference-DOI: 10.1074/JBC.M111.243865

(-) Compounds

Molecule 1 - PROTEIN MXIG
    Atcc: 700930
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET14B
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Fragment: N-TERMINAL FORKHEAD ASSOCIATED DOMAIN, RESIDUES 6-112
    Organism Scientific: SHIGELLA FLEXNERI
    Organism Taxid: 623
    Strain: 301
    Synonym: MXIG
    Variant: SEROTYPE 2A

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2XXS)

(-) Sites  (0, 0)

(no "Site" information available for 2XXS)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2XXS)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2XXS)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2XXS)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2XXS)

(-) Exons   (0, 0)

(no "Exon" information available for 2XXS)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:107
 aligned with MXIG_SHIFL | P0A221 from UniProtKB/Swiss-Prot  Length:371

    Alignment length:107
                                    15        25        35        45        55        65        75        85        95       105       
           MXIG_SHIFL     6 NSNLAPFRLLVKLTNGVGDEFPLYYGNNLIVLGRTIETLEFGNDNFPENIIPVTDSKSDGIIYLTISKDNICQFSDEKGEQIDINSQFNSFEYDGISFHLKNMREDK 112
               SCOP domains ----------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------PrgH-2xxsA01 A:7-107                                                                                  Pfam domains
         Sec.struct. author ......eeeeee.....eeeee...eeeeeee.hhhhhh.........eeeee......eeeeeeee...eeeeee.............eeee..eeeeeee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------- Transcript
                 2xxs A   1 NSNLAPFRLLVKLTNGVGDEFPLYYGNNLIVLGRTIETLEFGNDNFPENIIPVTDSKSDGIIYLTISKDNICQFSDEKGEQIDINSQFNSFEYDGISFHLKNMREDK 107
                                    10        20        30        40        50        60        70        80        90       100
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2XXS)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2XXS)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: no clan defined [family: PrgH] (2)

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)
Chain A   (MXIG_SHIFL | P0A221)
biological process
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0009279    cell outer membrane    A lipid bilayer that forms the outermost membrane of the cell envelope; enriched in polysaccharide and protein; the outer leaflet of the membrane contains specific lipopolysaccharide structures.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2xxs)
 
  Sites
(no "Sites" information available for 2xxs)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2xxs)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2xxs
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MXIG_SHIFL | P0A221
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  MXIG_SHIFL | P0A221
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MXIG_SHIFL | P0A221: 4a4y

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2XXS)