|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2X8W) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2X8W) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2X8W) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2X8W) |
Exons (0, 0)| (no "Exon" information available for 2X8W) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:125 aligned with B3VH91_9DEIN | B3VH91 from UniProtKB/TrEMBL Length:132 Alignment length:125 10 20 30 40 50 60 70 80 90 100 110 120 B3VH91_9DEIN 1 MRALALIAHDAKKEEMVAFCQRHREVLARFPLVATGTTGRRIEEATGLTVEKLLSGPLGGDQQMGARVAEGRILAVIFFRDPLTAQPHEPDVQALLRVCDVHGVPLATNPMAAEALIPWLQSLVG 125 SCOP domains d2x8wa_ A: automated matches SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------MGS-2x8wA01 A:15-108 ----------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript 2x8w A 1 MRALALIAHDAKKEEMVAFCQRHREVLARFPLVATGTTGRRIEEATGLTVEKLLSGPLGGDQQMGARVAEGRILAVIFFRDPLTAQPHEPDVQALLRVCDVHGVPLATNPMAAEALIPWLQSLVG 125 10 20 30 40 50 60 70 80 90 100 110 120
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2X8W) |
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (3, 3)|
Asymmetric Unit(hide GO term definitions) Chain A (B3VH91_9DEIN | B3VH91)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|