|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric/Biological Unit (2, 2) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2X7B) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2X7B) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2X7B) |
PROSITE Motifs (1, 1)| Asymmetric/Biological Unit (1, 1) |
Exons (0, 0)| (no "Exon" information available for 2X7B) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:156 aligned with NAT_SULSO | Q980R9 from UniProtKB/Swiss-Prot Length:167 Alignment length:156 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 NAT_SULSO 11 DFTLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAIVDNSVVGYIMPRIEWGFSNIKQLPSLVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYPAIALYEKLNFKKVKVLKGYYADGEDAYLMARP 166 SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE -GNAT PDB: A:12-166 UniProt: 12-167 PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 2x7b A 11 DFTLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAIVDNSVVGYIMPRIEWGFSNIKQLPSLVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYPAIALYEKLNFKKVKVLKGYYADGEDAYLMARP 166 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2X7B) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2X7B) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2X7B) |
Gene Ontology (8, 8)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (NAT_SULSO | Q980R9)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|