2WZJ - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   CATALYTIC AND UBA DOMAIN OF KINASE MARK2/(PAR-1) K82R, T208E DOUBLE MUTANT

Authors :   S. Panneerselvam, A. Marx, E. -M. Mandelkow, E. Mandelkow

Date :   30 Nov 09 (Deposition) - 22 Dec 09 (Release) - 16 Jun 10 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.79

Chains :   Asym. Unit : A,B,C,D,E,F
Biol. Unit 1: D,E  (1x)
Biol. Unit 2: A,F  (1x)
Biol. Unit 3: B,C  (1x)

Keywords :   Uba Domain, Transferase, Serine/Threonine-Protein Kinase, Signaling Protein, S/T Protein Kinase, Differentiation, Developmental Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. Marx, C. Nugoor, S. Panneerselvam, E. Mandelkow
Structure And Function Of Polarity-Inducing Kinase Family Mark/Par-1 Within The Branch Of Ampk/Snf1- Related Kinases.
Faseb J. V. 24 1637 2010
PubMed-ID: 20071654 | Reference-DOI: 10.1096/FJ.09-148064
(for further references see the PDB file header)

Molecule 1 - SERINE/THREONINE-PROTEIN KINASE MARK2
	Chains	:	A, B, C, D, E, F
	EC Number	:	2.7.11.1
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PDEST17
	Expression System Strain	:	BL21AI
	Expression System Taxid	:	511693
	Expression System Vector Type	:	PLASMID
	Fragment	:	CATALYTIC AND UBA DOMAINS, RESIDUES 39-364
	Mutation	:	YES
	Organism Common	:	RAT
	Organism Scientific	:	RATTUS NORVEGICUS
	Organism Taxid	:	10116
	Synonym	:	MAP/MICROTUBULE AFFINITY-REGULATING KINASE 2, ELKL MOTIF KINASE, EMK1, MARK2

		1	2	3	4	5	6
Asymmetric Unit	:	A	B	C	D	E	F
Biological Unit 1 (1x)	:				D	E
Biological Unit 2 (1x)	:	A					F
Biological Unit 3 (1x)	:		B	C

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2WZJ)

(no "Site" information available for 2WZJ)

Asymmetric Unit

No.	Residues
1	A:210	-	F:210
2	B:210	-	C:210
3	D:210	-	E:210

(no "Cis Peptide Bond" information available for 2WZJ)

(no "SAP(SNP)/Variant" information available for 2WZJ)

Asymmetric Unit (3, 18)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	MARK2_RAT	59-82	6	A:59-81 B:59-81 C:59-81 D:59-81 E:59-81 F:59-81
2	PROTEIN_KINASE_ST	PS00108	Serine/Threonine protein kinases active-site signature.	MARK2_RAT	171-183	6	A:171-183 B:171-183 C:171-183 D:171-183 E:171-183 F:171-183
3	UBA	PS50030	Ubiquitin-associated domain (UBA) profile.	MARK2_RAT	323-362	6	A:323-362 B:323-362 C:323-362 D:323-362 E:323-362 F:323-362

Biological Unit 1 (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	MARK2_RAT	59-82	2	- - - D:59-81 E:59-81 -
2	PROTEIN_KINASE_ST	PS00108	Serine/Threonine protein kinases active-site signature.	MARK2_RAT	171-183	2	- - - D:171-183 E:171-183 -
3	UBA	PS50030	Ubiquitin-associated domain (UBA) profile.	MARK2_RAT	323-362	2	- - - D:323-362 E:323-362 -

Biological Unit 2 (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	MARK2_RAT	59-82	2	A:59-81 - - - - F:59-81
2	PROTEIN_KINASE_ST	PS00108	Serine/Threonine protein kinases active-site signature.	MARK2_RAT	171-183	2	A:171-183 - - - - F:171-183
3	UBA	PS50030	Ubiquitin-associated domain (UBA) profile.	MARK2_RAT	323-362	2	A:323-362 - - - - F:323-362

Biological Unit 3 (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	MARK2_RAT	59-82	2	- B:59-81 C:59-81 - - -
2	PROTEIN_KINASE_ST	PS00108	Serine/Threonine protein kinases active-site signature.	MARK2_RAT	171-183	2	- B:171-183 C:171-183 - - -
3	UBA	PS50030	Ubiquitin-associated domain (UBA) profile.	MARK2_RAT	323-362	2	- B:323-362 C:323-362 - - -

Asymmetric Unit (10, 60)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSRNOT00000028763	1	ENSRNOE00000431295	chr1:210022099-210022019	81	MARK2_RAT	1-18	18	0	-	-
1.2	ENSRNOT00000028763	2	ENSRNOE00000442142	chr1:209972642-209972463	180	MARK2_RAT	19-78	60	6	A:49-78 (gaps) B:49-78 (gaps) C:49-78 (gaps) D:46-78 (gaps) E:49-78 (gaps) F:49-78 (gaps)	30 30 30 33 30 30
1.3	ENSRNOT00000028763	3	ENSRNOE00000206780	chr1:209972235-209972182	54	MARK2_RAT	79-96	18	6	A:79-96 B:79-96 C:79-96 D:79-96 E:79-96 F:79-96	18 18 18 18 18 18
1.4	ENSRNOT00000028763	4	ENSRNOE00000206781	chr1:209969442-209969394	49	MARK2_RAT	97-113	17	6	A:97-113 B:97-113 C:97-113 D:97-113 E:97-113 F:97-113	17 17 17 17 17 17
1.5	ENSRNOT00000028763	5	ENSRNOE00000206782	chr1:209969130-209969065	66	MARK2_RAT	113-135	23	6	A:113-135 B:113-135 C:113-135 D:113-135 E:113-135 F:113-135	23 23 23 23 23 23
1.6	ENSRNOT00000028763	6	ENSRNOE00000206783	chr1:209968946-209968876	71	MARK2_RAT	135-158	24	6	A:135-158 B:135-158 C:135-158 D:135-158 E:135-158 F:135-158	24 24 24 24 24 24
1.7	ENSRNOT00000028763	7	ENSRNOE00000206784	chr1:209968661-209968605	57	MARK2_RAT	159-177	19	6	A:159-177 B:159-177 C:159-177 D:159-177 E:159-177 F:159-177	19 19 19 19 19 19
1.8	ENSRNOT00000028763	8	ENSRNOE00000206785	chr1:209967997-209967761	237	MARK2_RAT	178-256	79	6	A:178-256 B:178-256 C:178-256 D:178-256 E:178-256 F:178-256	79 79 79 79 79 79
1.9	ENSRNOT00000028763	9	ENSRNOE00000206786	chr1:209967144-209967025	120	MARK2_RAT	257-296	40	6	A:257-296 B:257-296 C:257-296 D:257-296 E:257-296 F:257-296	40 40 40 40 40 40
1.10b	ENSRNOT00000028763	10b	ENSRNOE00000206787	chr1:209966915-209966816	100	MARK2_RAT	297-330	34	6	A:297-330 B:297-330 C:297-330 D:297-330 E:297-330 F:297-330	34 34 34 34 34 34
1.11b	ENSRNOT00000028763	11b	ENSRNOE00000206788	chr1:209966731-209966619	113	MARK2_RAT	330-367	38	6	A:330-363 B:330-363 C:330-363 D:330-363 E:330-363 F:330-363	34 34 34 34 34 34
1.12	ENSRNOT00000028763	12	ENSRNOE00000206789	chr1:209965747-209965615	133	MARK2_RAT	368-412	45	0	-	-
1.13	ENSRNOT00000028763	13	ENSRNOE00000206790	chr1:209965379-209965207	173	MARK2_RAT	412-469	58	0	-	-
1.14	ENSRNOT00000028763	14	ENSRNOE00000206791	chr1:209964998-209964901	98	MARK2_RAT	470-502	33	0	-	-
1.16	ENSRNOT00000028763	16	ENSRNOE00000206792	chr1:209963423-209963166	258	MARK2_RAT	502-588	87	0	-	-
1.17	ENSRNOT00000028763	17	ENSRNOE00000369651	chr1:209962194-209962168	27	MARK2_RAT	588-597	10	0	-	-
1.18	ENSRNOT00000028763	18	ENSRNOE00000206793	chr1:209960262-209960218	45	MARK2_RAT	597-612	16	0	-	-
1.19	ENSRNOT00000028763	19	ENSRNOE00000206800	chr1:209959623-209958925	699	MARK2_RAT	612-731	120	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:310
 aligned with MARK2_RAT | O08679 from UniProtKB/Swiss-Prot  Length:722

    Alignment length:315
                                    58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358     
            MARK2_RAT    49 HIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY 363
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2wzjA01 A:4     9-131 Phosphorylase Kinase; domain 1                               2wzjA02 A:132-321 Transferase(Phosphotransferase) domain 1                                                                                                                                    2wzjA03 A:322-363                          CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee.-----..eeeeee.....eeeeeeee.hhhhhhhhhhhhhhhhhhhhh.......eeeeee...eeeeeee....eehhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee....................hhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh........hhhhhhhhhhhh..hhhhh.hhhhhh..hhhhh..................hhhhhhhhhh...hhhhhhhhhhh...hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------PROTEIN_KINASE_ATP      ----------------------------------------------------------------------------------------PROTEIN_KINAS-------------------------------------------------------------------------------------------------------------------------------------------UBA  PDB: A:323-362 UniProt: 323-362    - PROSITE
           Transcript 1 (1) Exon 1.2  PDB: A:49-78 (gaps) Exon 1.3          Exon 1.4         ---------------------Exon 1.6  PDB: A:135-158Exon 1.7           Exon 1.8  PDB: A:178-256 UniProt: 178-256                                      Exon 1.9  PDB: A:257-296                Exon 1.10b  PDB: A:297-330        --------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------Exon 1.5  PDB: A:113-13--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.11b  PDB: A:330-363         Transcript 1 (2)
                 2wzj A  49 HIGNYRLLKTI-----AKVKLARHILTGKEVAVRIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDEFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY 363
                                    58|     | 68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358     
                                     59    65

Chain B from PDB  Type:PROTEIN  Length:310
 aligned with MARK2_RAT | O08679 from UniProtKB/Swiss-Prot  Length:722

    Alignment length:315
                                    58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358     
            MARK2_RAT    49 HIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY 363
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2wzjB01 B:4     9-131 Phosphorylase Kinase; domain 1                               2wzjB02 B:132-321 Transferase(Phosphotransferase) domain 1                                                                                                                                    2wzjB03 B:322-363                          CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee.-----..eeeeee.....eeeeeeee.hhhhhhhhhhhhhhhhhhhhh.......eeeeee...eeeeeee.....hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh...........eee.....eee....................hhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh........hhhhhhhhhhhh..hhhhh.hhhhhh.hhhhhh.hhhhh............hhhhhhhhhh...hhhhhhhhhhh...hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------PROTEIN_KINASE_ATP      ----------------------------------------------------------------------------------------PROTEIN_KINAS-------------------------------------------------------------------------------------------------------------------------------------------UBA  PDB: B:323-362 UniProt: 323-362    - PROSITE
           Transcript 1 (1) Exon 1.2  PDB: B:49-78 (gaps) Exon 1.3          Exon 1.4         ---------------------Exon 1.6  PDB: B:135-158Exon 1.7           Exon 1.8  PDB: B:178-256 UniProt: 178-256                                      Exon 1.9  PDB: B:257-296                Exon 1.10b  PDB: B:297-330        --------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------Exon 1.5  PDB: B:113-13--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.11b  PDB: B:330-363         Transcript 1 (2)
                 2wzj B  49 HIGNYRLLKTI-----AKVKLARHILTGKEVAVRIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDEFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY 363
                                    58|     | 68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358     
                                     59    65

Chain C from PDB  Type:PROTEIN  Length:310
 aligned with MARK2_RAT | O08679 from UniProtKB/Swiss-Prot  Length:722

    Alignment length:315
                                    58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358     
            MARK2_RAT    49 HIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY 363
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2wzjC01 C:4     9-131 Phosphorylase Kinase; domain 1                               2wzjC02 C:132-321 Transferase(Phosphotransferase) domain 1                                                                                                                                    2wzjC03 C:322-363                          CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee.-----.eeeeeee.....eeeeeeee....hhhhhhhhhhhhhhhhhh.......eeeeee...eeeeeee....eehhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh...........eee.....eee....................hhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh........hhhhhhhhhhhh..hhhhh.hhhhhh........hhhhh............hhhhhhhhhh...hhhhhhhhhhh...hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------PROTEIN_KINASE_ATP      ----------------------------------------------------------------------------------------PROTEIN_KINAS-------------------------------------------------------------------------------------------------------------------------------------------UBA  PDB: C:323-362 UniProt: 323-362    - PROSITE
           Transcript 1 (1) Exon 1.2  PDB: C:49-78 (gaps) Exon 1.3          Exon 1.4         ---------------------Exon 1.6  PDB: C:135-158Exon 1.7           Exon 1.8  PDB: C:178-256 UniProt: 178-256                                      Exon 1.9  PDB: C:257-296                Exon 1.10b  PDB: C:297-330        --------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------Exon 1.5  PDB: C:113-13--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.11b  PDB: C:330-363         Transcript 1 (2)
                 2wzj C  49 HIGNYRLLKTI-----AKVKLARHILTGKEVAVRIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDEFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY 363
                                    58|     | 68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358     
                                     59    65

Chain D from PDB  Type:PROTEIN  Length:313
 aligned with MARK2_RAT | O08679 from UniProtKB/Swiss-Prot  Length:722

    Alignment length:318
                                    55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355        
            MARK2_RAT    46 EQPHIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY 363
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 2wzjD01 D:46-1     31 Phosphorylase Kinase; domain 1                                  2wzjD02 D:132-321 Transferase(Phosphotransferase) domain 1                                                                                                                                    2wzjD03 D:322-363                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...ee..eeeeee.-----..eeeeee.....eeeeeeee.hhhhhhhhhhhhhhhhhhhhh.......eeeeee...eeeeeee....eehhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh...........eee.....eee....................hhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh........hhhhhhhhhhhh..hhhhh.hhhhhh.hhhhhh..................hhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -------------PROTEIN_KINASE_ATP      ----------------------------------------------------------------------------------------PROTEIN_KINAS-------------------------------------------------------------------------------------------------------------------------------------------UBA  PDB: D:323-362 UniProt: 323-362    - PROSITE
           Transcript 1 (1) Exon 1.2  PDB: D:46-78 (gaps)    Exon 1.3          Exon 1.4         ---------------------Exon 1.6  PDB: D:135-158Exon 1.7           Exon 1.8  PDB: D:178-256 UniProt: 178-256                                      Exon 1.9  PDB: D:257-296                Exon 1.10b  PDB: D:297-330        --------------------------------- Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------Exon 1.5  PDB: D:113-13--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.11b  PDB: D:330-363         Transcript 1 (2)
                 2wzj D  46 EQPHIGNYRLLKTI-----AKVKLARHILTGKEVAVRIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDEFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY 363
                                    55   |    65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355        
                                        59    65

Chain E from PDB  Type:PROTEIN  Length:310
 aligned with MARK2_RAT | O08679 from UniProtKB/Swiss-Prot  Length:722

    Alignment length:315
                                    58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358     
            MARK2_RAT    49 HIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY 363
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2wzjE01 E:4     9-131 Phosphorylase Kinase; domain 1                               2wzjE02 E:132-321 Transferase(Phosphotransferase) domain 1                                                                                                                                    2wzjE03 E:322-363                          CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee.-----..eeeeee.....eeeeeeee....hhhhhhhhhhhhhhhhhh.......eeeeee...eeeeee......hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh...........eee.....eee....................hhhhhhhhhhh......hhhhhhhhhhhhhhhh.........hhhhhhhhhhhh........hhhhhhhhhhhh........hhhhhh.hhhhhh..................hhhhhhhhhh...hhhhhhhhhhh...hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------PROTEIN_KINASE_ATP      ----------------------------------------------------------------------------------------PROTEIN_KINAS-------------------------------------------------------------------------------------------------------------------------------------------UBA  PDB: E:323-362 UniProt: 323-362    - PROSITE
           Transcript 1 (1) Exon 1.2  PDB: E:49-78 (gaps) Exon 1.3          Exon 1.4         ---------------------Exon 1.6  PDB: E:135-158Exon 1.7           Exon 1.8  PDB: E:178-256 UniProt: 178-256                                      Exon 1.9  PDB: E:257-296                Exon 1.10b  PDB: E:297-330        --------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------Exon 1.5  PDB: E:113-13--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.11b  PDB: E:330-363         Transcript 1 (2)
                 2wzj E  49 HIGNYRLLKTI-----AKVKLARHILTGKEVAVRIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDEFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY 363
                                    58|     | 68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358     
                                     59    65

Chain F from PDB  Type:PROTEIN  Length:310
 aligned with MARK2_RAT | O08679 from UniProtKB/Swiss-Prot  Length:722

    Alignment length:315
                                    58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358     
            MARK2_RAT    49 HIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY 363
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2wzjF01 F:4     9-131 Phosphorylase Kinase; domain 1                               2wzjF02 F:132-321 Transferase(Phosphotransferase) domain 1                                                                                                                                    2wzjF03 F:322-363                          CATH domains
           Pfam domains (1) ----Pkinase     -2wzjF01 F:53-304                                                                                                                                                                                                                               ----------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) ----Pkinase     -2wzjF02 F:53-304                                                                                                                                                                                                                               ----------------------------------------------------------- Pfam domains (2)
           Pfam domains (3) ----Pkinase     -2wzjF03 F:53-304                                                                                                                                                                                                                               ----------------------------------------------------------- Pfam domains (3)
           Pfam domains (4) ----Pkinase     -2wzjF04 F:53-304                                                                                                                                                                                                                               ----------------------------------------------------------- Pfam domains (4)
           Pfam domains (5) ----Pkinase     -2wzjF05 F:53-304                                                                                                                                                                                                                               ----------------------------------------------------------- Pfam domains (5)
           Pfam domains (6) ----Pkinase     -2wzjF06 F:53-304                                                                                                                                                                                                                               ----------------------------------------------------------- Pfam domains (6)
         Sec.struct. author ....eeeeee.-----.eeeeeee.....eeeeeeee....hhhhhhhhhhhhhhhhhh.......eeeeee...eeeeeee.....hhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee....................hhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh........hhhhhhhhhhhh........hhhhhhhhhhhh..hhhhh.hhhhhh.hhhhhh..................hhhhhhhhhh.....hhhhhhhhhh..hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------PROTEIN_KINASE_ATP      ----------------------------------------------------------------------------------------PROTEIN_KINAS-------------------------------------------------------------------------------------------------------------------------------------------UBA  PDB: F:323-362 UniProt: 323-362    - PROSITE
           Transcript 1 (1) Exon 1.2  PDB: F:49-78 (gaps) Exon 1.3          Exon 1.4         ---------------------Exon 1.6  PDB: F:135-158Exon 1.7           Exon 1.8  PDB: F:178-256 UniProt: 178-256                                      Exon 1.9  PDB: F:257-296                Exon 1.10b  PDB: F:297-330        --------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------Exon 1.5  PDB: F:113-13--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.11b  PDB: F:330-363         Transcript 1 (2)
                 2wzj F  49 HIGNYRLLKTI-----AKVKLARHILTGKEVAVRIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDEFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY 363
                                    58|     | 68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358     
                                     59    65

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2WZJ)

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Phosphorylase Kinase; domain 1 (1392)

Homologous Superfamily: Phosphorylase Kinase; domain 1 (1392)

Rat (Rattus norvegicus) (4)

1a	2wzjD01	D:46-131
1b	2wzjA01	A:49-131
1c	2wzjB01	B:49-131
1d	2wzjC01	C:49-131
1e	2wzjE01	E:49-131
1f	2wzjF01	F:49-131

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Helicase, Ruva Protein; domain 3 (218)

Homologous Superfamily: DNA helicase RuvA subunit, C-terminal domain (65)

Rat (Rattus norvegicus) (1)

2a	2wzjA03	A:322-363
2b	2wzjB03	B:322-363
2c	2wzjC03	C:322-363
2d	2wzjD03	D:322-363
2e	2wzjE03	E:322-363
2f	2wzjF03	F:322-363

Topology: Transferase(Phosphotransferase); domain 1 (1379)

Homologous Superfamily: Transferase(Phosphotransferase) domain 1 (1379)

Rat (Rattus norvegicus) (4)

3a	2wzjA02	A:132-321
3b	2wzjB02	B:132-321
3c	2wzjC02	C:132-321
3d	2wzjD02	D:132-321
3e	2wzjE02	E:132-321
3f	2wzjF02	F:132-321

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: PKinase (934)

Family: Pkinase (680)

Rattus norvegicus (Rat) (10)

1a	Pkinase-2wzjF01	F:53-304
1b	Pkinase-2wzjF02	F:53-304
1c	Pkinase-2wzjF03	F:53-304
1d	Pkinase-2wzjF04	F:53-304
1e	Pkinase-2wzjF05	F:53-304
1f	Pkinase-2wzjF06	F:53-304

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E,F (MARK2_RAT | O08679)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0008289	lipid binding	Interacting selectively and non-covalently with a lipid.
	GO:0000287	magnesium ion binding	Interacting selectively and non-covalently with magnesium (Mg) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004672	protein kinase activity	Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
	GO:0004674	protein serine/threonine kinase activity	Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
	GO:0050321	tau-protein kinase activity	Catalysis of the reaction: ATP + tau-protein = ADP + O-phospho-tau-protein.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0016055	Wnt signaling pathway	The series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell and ending with a change in cell state.
	GO:0030154	cell differentiation	The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
	GO:0030010	establishment of cell polarity	The specification and formation of anisotropic intracellular organization or cell growth patterns.
	GO:0045197	establishment or maintenance of epithelial cell apical/basal polarity	Any cellular process that results in the specification, formation or maintenance of the apicobasal polarity of an epithelial cell.
	GO:0035556	intracellular signal transduction	The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
	GO:0007275	multicellular organism development	The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
	GO:0001764	neuron migration	The characteristic movement of an immature neuron from germinal zones to specific positions where they will reside as they mature.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0010976	positive regulation of neuron projection development	Any process that increases the rate, frequency or extent of neuron projection development. Neuron projection development is the process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites).
	GO:0046777	protein autophosphorylation	The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
	GO:0006468	protein phosphorylation	The process of introducing a phosphate group on to a protein.
	GO:0050770	regulation of axonogenesis	Any process that modulates the frequency, rate or extent of axonogenesis, the generation of an axon, the long process of a neuron.
	GO:0051493	regulation of cytoskeleton organization	Any process that modulates the frequency, rate or extent of the formation, arrangement of constituent parts, or disassembly of cytoskeletal structures.
cellular component
	GO:0005884	actin filament	A filamentous structure formed of a two-stranded helical polymer of the protein actin and associated proteins. Actin filaments are a major component of the contractile apparatus of skeletal muscle and the microfilaments of the cytoskeleton of eukaryotic cells. The filaments, comprising polymerized globular actin molecules, appear as flexible structures with a diameter of 5-9 nm. They are organized into a variety of linear bundles, two-dimensional networks, and three dimensional gels. In the cytoskeleton they are most highly concentrated in the cortex of the cell just beneath the plasma membrane.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0016328	lateral plasma membrane	The portion of the plasma membrane at the lateral side of the cell. In epithelial cells, lateral plasma membranes are on the sides of cells which lie at the interface of adjacent cells.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0097427	microtubule bundle	An arrangement of closely apposed microtubules running parallel to each other.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2wzj)

	Sites
(no "Sites" information available for 2wzj)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2wzj)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2wzj
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	MARK2_RAT \| O08679
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.11.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	MARK2_RAT \| O08679
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	MARK2_RAT \| O08679	:	1y8g 1zmu 1zmv 1zmw 2r0i

1y8g	CATALYTIC AND UBIQUTIN-ASSOCIATED DOMAINS OF MARK2/PAR-1:INACTIVE DOUBLE MUTANT WITH SELENOMETHIONINE
1zmu	CATALYTIC AND UBIQUTIN-ASSOCIATED DOMAINS OF MARK2/PAR-1:WILD TYPE
1zmv	CATALYTIC AND UBIQUTIN-ASSOCIATED DOMAINS OF MARK2/PAR-1:K82R MUTANT
1zmw	CATALYTIC AND UBIQUTIN-ASSOCIATED DOMAINS OF MARK2/PAR-1:T208A/S212A INACTIVE DOUBLE MUTANT

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (3, 3)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 18)

Exons (10, 60)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (3, 18)

Pfam Domains (1, 6)

Gene Ontology (31, 31)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File