|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric/Biological Unit (2, 2) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2WY4) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2WY4) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2WY4) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2WY4) |
Exons (0, 0)| (no "Exon" information available for 2WY4) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:139 aligned with Q0P842_CAMJE | Q0P842 from UniProtKB/TrEMBL Length:140 Alignment length:139 11 21 31 41 51 61 71 81 91 101 111 121 131 Q0P842_CAMJE 2 TKEQIQIIKDCVPILQKNGEDLTNEFYKIMFNDYPEVKPMFNMEKQISGEQPKALAMAILMAAKNIENLENMRSFVDKVAITHVNLGVKEEHYPIVGACLLKAIKNLLNPDEATLKAWEVAYGKIAKFYIDIEKKLYDK 140 SCOP domains d2wy4a_ A: automated matches SCOP domains CATH domains 2wy4A00 A:2-140 Globins CATH domains Pfam domains ---Globin-2wy4A01 A:5-102 -------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2wy4 A 2 TKEQIQIIKDCVPILQKNGEDLTNEFYKIMFNDYPEVKPMFNMEKQISGEQPKALAMAILMAAKNIENLENMRSFVDKVAITHVNLGVKEEHYPIVGACLLKAIKNLLNPDEATLKAWEVAYGKIAKFYIDIEKKLYDK 140 11 21 31 41 51 61 71 81 91 101 111 121 131
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (1, 1)| Asymmetric/Biological Unit |
Gene Ontology (6, 6)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Q0P842_CAMJE | Q0P842)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|