|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric/Biological Unit (2, 2) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (3, 3)
Asymmetric/Biological Unit
|
||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2WC5) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2WC5) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2WC5) |
Exons (0, 0)| (no "Exon" information available for 2WC5) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:141 aligned with OBP2_BOMMO | P34170 from UniProtKB/Swiss-Prot Length:160 Alignment length:141 29 39 49 59 69 79 89 99 109 119 129 139 149 159 OBP2_BOMMO 20 TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHFWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNMDEYIKGFPNGQVLAEKMVKLIHNCEKQFDTETDDCTRVVKVAACFKKDSRKEGIAPEVAMIEAVIEKY 160 SCOP domains d2wc5a_ A: automated matches SCOP domains CATH domains 2wc5A00 A:1-141 [code=1.10.238.20, no name defined] CATH domains Pfam domains PBP_GOBP-2wc5A01 A:1-123 ------------------ Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2wc5 A 1 TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHFWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNMDEYIKSFPNGQVLAEKMVKLIHNCEKQFDTETDDCTRVVKVAACFKEDSRKEGIAPEVAMVEAVIEKY 141 10 20 30 40 50 60 70 80 90 100 110 120 130 140
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (4, 4)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (OBP2_BOMMO | P34170)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|