|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 8)
Asymmetric Unit (3, 8)
|
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2W7V) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2W7V) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2W7V) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2W7V) |
Exons (0, 0)| (no "Exon" information available for 2W7V) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:82 aligned with Q87TC9_VIBPA | Q87TC9 from UniProtKB/TrEMBL Length:404 Alignment length:83 331 341 351 361 371 381 391 401 Q87TC9_VIBPA 322 STDVAMLSWLAALPATLGQVKDLEITSFKYDGQRGEVRIHARSSDFQPFEQARVKLAEKFNVEQGQLNRSDNVVMGSFVLKRQ 404 SCOP domains ----------------------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------- Transcript 2w7v A 322 STDVAmLSWLAALPATLGQVKDLEITSFKYDGQRGEVRIHARSSDFQPFEQARVKLAEKFNVEQGQLNRS-NVVmGSFVLKRQ 404 | 331 341 351 361 371 381 391 | | 401 | 391 | | 327-MSE 393 | 396-MSE Chain B from PDB Type:PROTEIN Length:82 aligned with Q87TC9_VIBPA | Q87TC9 from UniProtKB/TrEMBL Length:404 Alignment length:83 331 341 351 361 371 381 391 401 Q87TC9_VIBPA 322 STDVAMLSWLAALPATLGQVKDLEITSFKYDGQRGEVRIHARSSDFQPFEQARVKLAEKFNVEQGQLNRSDNVVMGSFVLKRQ 404 SCOP domains ----------------------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------------------- CATH domains Pfam domains (1) GspL_C-2w7vB01 B:322-404 Pfam domains (1) Pfam domains (2) GspL_C-2w7vB02 B:322-404 Pfam domains (2) SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------- Transcript 2w7v B 322 STDVAmLSWLAALPATLGQVKDLEITSFKYDGQRGEVRIHARSSDFQPFEQARVKLAEKFNVEQGQLNRS-NVVmGSFVLKRQ 404 | 331 341 351 361 371 381 391 | | 401 327-MSE 391 | | 393 | 396-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2W7V) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2W7V) |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (5, 5)|
Asymmetric Unit(hide GO term definitions) Chain A,B (Q87TC9_VIBPA | Q87TC9)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|