|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2W1R) |
Sites (0, 0)| (no "Site" information available for 2W1R) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2W1R) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2W1R) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2W1R) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2W1R) |
Exons (0, 0)| (no "Exon" information available for 2W1R) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:117 aligned with SP5T_BACSU | P37554 from UniProtKB/Swiss-Prot Length:178 Alignment length:117 66 76 86 96 106 116 126 136 146 156 166 SP5T_BACSU 57 DFAKEYADALYDSLGHSVLICDRDVYIAVSGSSKKDYLNKSISEMLERTMDQRSSVLESDAKSVQLVNGIDEDMNSYTVGPIVANGDPIGAVVIFSKDQTMGEVEHKAVETAAGFLA 173 SCOP domains --------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------- Transcript 2w1r A 57 DFAKEYADALYDSLGHSVLICDRDVYIAVSGSSKKDYLNKSISEMLERTMDQRSSVLESDAKSVQLVNGIDEDMNSYTVGPIVANGDPIGAVVIFSKDQTMGEVEHKAVETAAGFLA 173 66 76 86 96 106 116 126 136 146 156 166
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2W1R) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2W1R) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2W1R) |
Gene Ontology (4, 4)|
Asymmetric Unit(hide GO term definitions) Chain A (SP5T_BACSU | P37554)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|