|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 9)| Asymmetric/Biological Unit (3, 9) |
Sites (6, 6)
Asymmetric Unit (6, 6)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2VS0) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2VS0) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2VS0) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2VS0) |
Exons (0, 0)| (no "Exon" information available for 2VS0) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:83 aligned with ESXA_STAA8 | Q2G189 from UniProtKB/Swiss-Prot Length:97 Alignment length:83 12 22 32 42 52 62 72 82 ESXA_STAA8 3 MIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQE 85 SCOP domains d2vs0a_ A: automated matches SCOP domains CATH domains ----------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------- Transcript 2vs0 A 3 mIKmSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQE 85 | | 12 22 32 42 52 62 72 82 | | 3-MSE 6-MSE Chain A from PDB Type:PROTEIN Length:83 aligned with ESXA_STAAM | Q99WU4 from UniProtKB/Swiss-Prot Length:97 Alignment length:83 12 22 32 42 52 62 72 82 ESXA_STAAM 3 MIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQE 85 SCOP domains d2vs0a_ A: automated matches SCOP domains CATH domains ----------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------- Transcript 2vs0 A 3 mIKmSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQE 85 | | 12 22 32 42 52 62 72 82 3-MSE 6-MSE Chain B from PDB Type:PROTEIN Length:84 aligned with ESXA_STAA8 | Q2G189 from UniProtKB/Swiss-Prot Length:97 Alignment length:84 13 23 33 43 53 63 73 83 ESXA_STAA8 4 IKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQD 87 SCOP domains d2vs0b_ B: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------ CATH domains Pfam domains (1) WXG100-2vs0B01 B:4-87 Pfam domains (1) Pfam domains (2) WXG100-2vs0B02 B:4-87 Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------ Transcript 2vs0 B 4 IKmSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQD 87 | 13 23 33 43 53 63 73 83 6-MSE Chain B from PDB Type:PROTEIN Length:84 aligned with ESXA_STAAM | Q99WU4 from UniProtKB/Swiss-Prot Length:97 Alignment length:84 13 23 33 43 53 63 73 83 ESXA_STAAM 4 IKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQD 87 SCOP domains d2vs0b_ B: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------ CATH domains Pfam domains (1) WXG100-2vs0B01 B:4-87 Pfam domains (1) Pfam domains (2) WXG100-2vs0B02 B:4-87 Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------ Transcript 2vs0 B 4 IKmSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQD 87 | 13 23 33 43 53 63 73 83 6-MSE
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2VS0) |
Pfam Domains (1, 2)
Asymmetric/Biological Unit
|
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (ESXA_STAAM | Q99WU4)
|
||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|