2VPI - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   HUMAN GMP SYNTHETASE - GLUTAMINASE DOMAIN

Authors :   M. Welin, L. Tresaugues, C. H. Arrowsmith, H. Berglund, R. D. Busam, R. Collins, L. G. Dahlgren, A. M. Edwards, S. Flodin, A. Flores, S. Graslund, M. Hammarstrom, M. D. Herman, I. Johansson, A. Kallas, T. Karlberg, T. Kotenyova, L. Lehtio, M. Moche, M. E. Nilsson, T. Nyman, C. Persson, J. Sagemark, L. Svensson, A. G. Thorsell, S. Van Der Berg, J. Weigelt, P. Nordlund, Structural Genomics Consortium (Sgc)

Date :   29 Feb 08 (Deposition) - 11 Mar 08 (Release) - 29 Apr 15 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.40

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Guanine Monophosphate Synthetase, Phosphoprotein, Gmp Synthetase, Gmp Biosynthesis, Glutamine Amidotransferase, Gmps, Ligase, Cytoplasm, Atp-Binding, Proto-Oncogene, Glutaminase Domain, Nucleotide-Binding, Purine Biosynthesis, Chromosomal Rearrangement (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Welin, L. Tresaugues, C. H. Arrowsmith, H. Berglund, R. D. Busam, R. Collins, L. G. Dahlgren, A. M. Edwards, S. Flodin, A. Flores, S. Graslund, M. Hammarstrom, M. D. Herman, I. Johansson, A. Kallas, T. Karlberg, T. Kotenyova, L. Lehtio, M. Moche, M. E. Nilsson, T. Nyman, C. Persson, J. Sagemark, L. Svensson, A. G. Thorsell, S. Van Den Berg, J. Weigelt, P. Nordlund
Human Gmp Synthetase - Glutaminase Domain
To Be Published
PubMed: search

Molecule 1 - GMP SYNTHASE
	Chains	:	A, B
	EC Number	:	6.3.5.2
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PNIC-BSA4
	Expression System Taxid	:	469008
	Fragment	:	GLUTAMINASE DOMAIN, RESIDUES 25-219
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	GLUTAMINE AMIDOTRANSFERASE, GMP SYNTHETASE

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2VPI)

(no "Site" information available for 2VPI)

(no "SS Bond" information available for 2VPI)

(no "Cis Peptide Bond" information available for 2VPI)

(no "SAP(SNP)/Variant" information available for 2VPI)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GMPS_ATP_PPASE	PS51553	GMP synthetase ATP pyrophosphatase (GMPS ATP-PPase) domain profile.	GUAA_HUMAN	217-435	2	A:217-219 B:217-219

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GMPS_ATP_PPASE	PS51553	GMP synthetase ATP pyrophosphatase (GMPS ATP-PPase) domain profile.	GUAA_HUMAN	217-435	1	A:217-219 -

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GMPS_ATP_PPASE	PS51553	GMP synthetase ATP pyrophosphatase (GMPS ATP-PPase) domain profile.	GUAA_HUMAN	217-435	1	- B:217-219

(no "Exon" information available for 2VPI)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:187
 aligned with GUAA_HUMAN | P49915 from UniProtKB/Swiss-Prot  Length:693

    Alignment length:196
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213      
           GUAA_HUMAN    24 YEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGGPNSVYAEDAPWFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLTHGDSVDKVADGFKVVARSGNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSGTFTV 219
               SCOP domains d2vpia_ A: automated matches                                                                                                                                                                         SCOP domains
               CATH domains 2vpiA00 A:24-219  [code=3.40.50.880, no name defined]                                                                                                                                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeee.....hhhhhhhhhhh...eee.....hhhhhhhhh..eeeeee---------....hhhhhh....eeeeehhhhhhhhhh...eeeeee...eeeeeee...hhhhh....eeeeee..eeee.......eeeeee..eeeeeee....eeee..........hhhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GMP PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2vpi A  24 MEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISG---------APWFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLTHGDSVDKVADGFKVVARSGNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSGTFTV 219
                                    33        43        53        63        73  |      -  |     93       103       113       123       133       143       153       163       173       183       193       203       213      
                                                                               76        86

Chain B from PDB  Type:PROTEIN  Length:186
 aligned with GUAA_HUMAN | P49915 from UniProtKB/Swiss-Prot  Length:693

    Alignment length:196
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213      
           GUAA_HUMAN    24 YEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGGPNSVYAEDAPWFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLTHGDSVDKVADGFKVVARSGNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSGTFTV 219
               SCOP domains d2vpib_ B: automated matches                                                                                                                                                                         SCOP domains
               CATH domains 2vpiB00 B:24-219  [code=3.40.50.880, no name defined]                                                                                                                                                CATH domains
           Pfam domains (1) -----GATase-2vpiB01 B:29-210                                                                                                                                                               --------- Pfam domains (1)
           Pfam domains (2) -----GATase-2vpiB02 B:29-210                                                                                                                                                               --------- Pfam domains (2)
         Sec.struct. author ....eeeee.....hhhhhhhhhhh...eee.....hhhhhhhhh..eeeeee----------...hhhhhh....eeeeehhhhhhhhhh...eeeeee...eeeeeee...hhhhh....eeeeee..eeee.......eeeeee..eeeeeee....eeee..........hhhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GMP PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2vpi B  24 MEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISG----------PWFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLTHGDSVDKVADGFKVVARSGNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSGTFTV 219
                                    33        43        53        63        73  |      -   |    93       103       113       123       133       143       153       163       173       183       193       203       213      
                                                                               76         87

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: Flavodoxin-like (1057)

Superfamily: Class I glutamine amidotransferase-like (173)

Family: automated matches (40)

Protein domain: automated matches (40)

Human (Homo sapiens) [TaxId: 9606] (1)

1a	d2vpia_	A:
1b	d2vpib_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: [code=3.40.50.880, no name defined] (97)

Human (Homo sapiens) (27)

1a	2vpiA00	A:24-219
1b	2vpiB00	B:24-219

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Glutaminase_I (73)

Family: GATase (26)

Homo sapiens (Human) (4)

1a	GATase-2vpiB01	B:29-210
1b	GATase-2vpiB02	B:29-210

Asymmetric Unit(hide GO term definitions)

Chain A,B (GUAA_HUMAN | P49915)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0003922	GMP synthase (glutamine-hydrolyzing) activity	Catalysis of the reaction: ATP + xanthosine 5'-phosphate + L-glutamine + H2O = AMP + diphosphate + GMP + L-glutamate.
	GO:0003921	GMP synthase activity	Catalysis of the reaction: ATP + xanthosine 5'-phosphate + NH3 = AMP + diphosphate + GMP.
	GO:0016874	ligase activity	Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0016462	pyrophosphatase activity	Catalysis of the hydrolysis of a pyrophosphate bond between two phosphate groups, leaving one phosphate on each of the two fragments.
biological process
	GO:0006177	GMP biosynthetic process	The chemical reactions and pathways resulting in the formation of GMP, guanosine monophosphate.
	GO:0006541	glutamine metabolic process	The chemical reactions and pathways involving glutamine, 2-amino-4-carbamoylbutanoic acid.
	GO:0009113	purine nucleobase biosynthetic process	The chemical reactions and pathways resulting in the formation of purine nucleobases, one of the two classes of nitrogen-containing ring compounds found in DNA and RNA, which include adenine and guanine.
	GO:0006164	purine nucleotide biosynthetic process	The chemical reactions and pathways resulting in the formation of a purine nucleotide, a compound consisting of nucleoside (a purine base linked to a deoxyribose or ribose sugar) esterified with a phosphate group at either the 3' or 5'-hydroxyl group of the sugar.
	GO:0009168	purine ribonucleoside monophosphate biosynthetic process	The chemical reactions and pathways resulting in the formation of purine ribonucleoside monophosphate, a compound consisting of a purine base linked to a ribose sugar esterified with phosphate on the sugar.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2vpi)

	Sites
(no "Sites" information available for 2vpi)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2vpi)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2vpi
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GUAA_HUMAN \| P49915
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	6.3.5.2
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GUAA_HUMAN \| P49915
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	GUAA_HUMAN \| P49915	:	2vxo

(no "Related Entries Specified in the PDB File" available for 2VPI)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (13, 13)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File