|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric Unit (2, 2) Biological Unit 1 (2, 4) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2VPA) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2VPA) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2VPA) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2VPA) |
Exons (0, 0)| (no "Exon" information available for 2VPA) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:204 aligned with Q9RW27_DEIRA | Q9RW27 from UniProtKB/TrEMBL Length:195 Alignment length:204 1 1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 Q9RW27_DEIRA - ---------MSDFYDPRERDPSVSRRPQNRQSDEWIRELLLRGTIARVATLWQGEDGAAFPFITPLAYAYRPEQGDLVYHTNVVGRLRANAGQGHPATLEVSEIGQFLPSNSPLELSVQYRSVMVFGTARVLAGEDARAALTTLSERVFPGLKVGETTRPISEDDLKRTSVYSLSIDRWSGKENWAEQAIQEEDWPALGPEWLG 195 SCOP domains d2vpaa_ A: automated matches SCOP domains CATH domains 2vpaA00 A:-19-195 Electron Transport, Fmn-binding Protein; Chain A CATH domains Pfam domains -------------------------------Pyridox_ox_2-2vpaA01 A:23-174 --------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 2vpa A -19 SYYHHHHHHLSDFYDPRERDPSVSRRPQNRQSDEWIRELLLRGTIARVATLWQGEDGAAFPFITPLAYAYRPEQGDLVYHTNVVGRLRANAGQGHPATLEVSEIGQFLPSNSPLELSVQYRSVMVFGTARVLAGEDARAALTTLSERVFPGLKVGETTRPISEDDLKRTSVYSLSIDRWSGKENWAEQAIQEEDWPALGPEWLG 195 -10| 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 -10| 2
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (3, 3)|
Asymmetric Unit(hide GO term definitions) Chain A (Q9RW27_DEIRA | Q9RW27)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|