|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (3, 5)
|
Asymmetric Unit (3, 3)
|
Asymmetric Unit
|
(no "Cis Peptide Bond" information available for 2VLW) |
(no "SAP(SNP)/Variant" information available for 2VLW) |
Asymmetric Unit (1, 2)
|
(no "Exon" information available for 2VLW) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:65 aligned with 3SIM7_DENAN | Q8QGR0 from UniProtKB/Swiss-Prot Length:86 Alignment length:65 31 41 51 61 71 81 3SIM7_DENAN 22 LTCVKSNSIWFPTSEDCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAEYRDVINCCGTDKCNK 86 SCOP domains ----------------------------------------------------------------- SCOP domains CATH domains 2vlwA00 A:1-65 CD59 CATH domains Pfam domains ----------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------SNAKE_TOXIN ---- PROSITE Transcript ----------------------------------------------------------------- Transcript 2vlw A 1 LTCVKSNSIWFPTSEDCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAEyRDVINCCGTDKCNK 65 10 20 30 40 50| 60 51-TYI Chain B from PDB Type:PROTEIN Length:65 aligned with 3SIM7_DENAN | Q8QGR0 from UniProtKB/Swiss-Prot Length:86 Alignment length:65 31 41 51 61 71 81 3SIM7_DENAN 22 LTCVKSNSIWFPTSEDCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAEYRDVINCCGTDKCNK 86 SCOP domains ----------------------------------------------------------------- SCOP domains CATH domains 2vlwB00 B:1-65 CD59 CATH domains Pfam domains ----------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------SNAKE_TOXIN ---- PROSITE Transcript ----------------------------------------------------------------- Transcript 2vlw B 1 LTCVKSNSIWFPTSEDCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAEyRDVINCCGTDKCNK 65 10 20 30 40 50| 60 51-TYI
|
(no "SCOP Domain" information available for 2VLW) |
Asymmetric Unit
|
(no "Pfam Domain" information available for 2VLW) |
Asymmetric Unit(hide GO term definitions) Chain A,B (3SIM7_DENAN | Q8QGR0)
|
|
|
|
|
|
|