|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric Unit (1, 2)
|
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2V6Y) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2V6Y) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2V6Y) |
Exons (0, 0)| (no "Exon" information available for 2V6Y) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:75 aligned with Q97ZJ7_SULSO | Q97ZJ7 from UniProtKB/TrEMBL Length:372 Alignment length:75 10 20 30 40 50 60 70 Q97ZJ7_SULSO 1 MSAQVMLEDMARKYAILAVKADKEGKVEDAITYYKKAIEVLSQIIVLYPESVARTAYEQMINEYKKRISYLEKVL 75 SCOP domains --------------------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------- Transcript 2v6y A 1 MSAQVMLEDMARKYAILAVKADKEGKVEDAITYYKKAIEVLSQIIVLYPESVARTAYEQMINEYKKRISYLEKVL 75 10 20 30 40 50 60 70 Chain B from PDB Type:PROTEIN Length:72 aligned with Q97ZJ7_SULSO | Q97ZJ7 from UniProtKB/TrEMBL Length:372 Alignment length:74 11 21 31 41 51 61 71 Q97ZJ7_SULSO 2 SAQVMLEDMARKYAILAVKADKEGKVEDAITYYKKAIEVLSQIIVLYPESVARTAYEQMINEYKKRISYLEKVL 75 SCOP domains -------------------------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------------------------- CATH domains Pfam domains (1) -----MIT-2v6yB01 B:7-75 Pfam domains (1) Pfam domains (2) -----MIT-2v6yB02 B:7-75 Pfam domains (2) SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------- Transcript 2v6y B 2 SAQVMLEDMARKYAILAVKADKEG--DDAITYYKKAIEVLSQIIVLYPESVARTAYEQMINEYKKRISYLEKVL 75 11 21 | | 31 41 51 61 71 25 28
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2V6Y) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2V6Y) |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (2, 2)|
Asymmetric Unit(hide GO term definitions) Chain A,B (Q97ZJ7_SULSO | Q97ZJ7)
|
||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|