|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (4, 18) Biological Unit 1 (2, 18) |
Asymmetric Unit (18, 18)
|
(no "SS Bond" information available for 2V08) |
(no "Cis Peptide Bond" information available for 2V08) |
(no "SAP(SNP)/Variant" information available for 2V08) |
(no "PROSITE Motif" information available for 2V08) |
(no "Exon" information available for 2V08) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:84 aligned with CYC6_SYNLI | P00114 from UniProtKB/Swiss-Prot Length:87 Alignment length:84 11 21 31 41 51 61 71 81 CYC6_SYNLI 2 DLANGAKVFSGNCAACHMGGGNVVMANKTLKKEALEQFGMNSEDAIIYQVQHGKNAMPAFAGRLTDEQIQDVAAYVLDQAAKGW 85 SCOP domains d2v08a_ A: automated matches SCOP domains CATH domains 2v08A00 A:3-86 Cytochrome c CATH domains Pfam domains ------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------ Transcript 2v08 A 3 DLATGAKVFSANCAACHAGGINLVNAEKTLKKEALEKFGMNSIVAITTQVTNGKAGMPAFKGRLTDDQIAAVAAYVLDQAEKGW 86 12 22 32 42 52 62 72 82 Chain A from PDB Type:PROTEIN Length:84 aligned with F2Z292_PHOLA | F2Z292 from UniProtKB/TrEMBL Length:86 Alignment length:84 12 22 32 42 52 62 72 82 F2Z292_PHOLA 3 DLATGAKVFSANCAACHAGGINLVNAEKTLKKEALEKFGMNSIVAITTVVTNGKAGMPAFKGRLTDDQIAAVAAYVLDQAEKGW 86 SCOP domains d2v08a_ A: automated matches SCOP domains CATH domains 2v08A00 A:3-86 Cytochrome c CATH domains Pfam domains ------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------ Transcript 2v08 A 3 DLATGAKVFSANCAACHAGGINLVNAEKTLKKEALEKFGMNSIVAITTQVTNGKAGMPAFKGRLTDDQIAAVAAYVLDQAEKGW 86 12 22 32 42 52 62 72 82 Chain B from PDB Type:PROTEIN Length:84 aligned with CYC6_SYNLI | P00114 from UniProtKB/Swiss-Prot Length:87 Alignment length:84 11 21 31 41 51 61 71 81 CYC6_SYNLI 2 DLANGAKVFSGNCAACHMGGGNVVMANKTLKKEALEQFGMNSEDAIIYQVQHGKNAMPAFAGRLTDEQIQDVAAYVLDQAAKGW 85 SCOP domains d2v08b_ B: automated matches SCOP domains CATH domains 2v08B00 B:3-86 Cytochrome c CATH domains Pfam domains (1) Cytochrome_CBB3-2v08B01 B:3-78 -------- Pfam domains (1) Pfam domains (2) Cytochrome_CBB3-2v08B02 B:3-78 -------- Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------ Transcript 2v08 B 3 DLATGAKVFSANCAACHAGGINLVNAEKTLKKEALEKFGMNSIVAITTQVTNGKAGMPAFKGRLTDDQIAAVAAYVLDQAEKGW 86 12 22 32 42 52 62 72 82 Chain B from PDB Type:PROTEIN Length:84 aligned with F2Z292_PHOLA | F2Z292 from UniProtKB/TrEMBL Length:86 Alignment length:84 12 22 32 42 52 62 72 82 F2Z292_PHOLA 3 DLATGAKVFSANCAACHAGGINLVNAEKTLKKEALEKFGMNSIVAITTVVTNGKAGMPAFKGRLTDDQIAAVAAYVLDQAEKGW 86 SCOP domains d2v08b_ B: automated matches SCOP domains CATH domains 2v08B00 B:3-86 Cytochrome c CATH domains Pfam domains (1) Cytochrome_CBB3-2v08B01 B:3-78 -------- Pfam domains (1) Pfam domains (2) Cytochrome_CBB3-2v08B02 B:3-78 -------- Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------ Transcript 2v08 B 3 DLATGAKVFSANCAACHAGGINLVNAEKTLKKEALEKFGMNSIVAITTQVTNGKAGMPAFKGRLTDDQIAAVAAYVLDQAEKGW 86 12 22 32 42 52 62 72 82
|
Asymmetric Unit
|
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B (CYC6_SYNLI | P00114)
Chain A,B (F2Z292_PHOLA | F2Z292)
|
|
|
|
|
|
|