|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2UV1) |
Sites (0, 0)| (no "Site" information available for 2UV1) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2UV1) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2UV1) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2UV1) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2UV1) |
Exons (0, 0)| (no "Exon" information available for 2UV1) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:78 aligned with GAM_LAMBD | P03702 from UniProtKB/Swiss-Prot Length:138 Alignment length:78 69 79 89 99 109 119 129 GAM_LAMBD 60 QQLAREEKEAELADDMEKGLPQHLFESLCIDHLQRHGASKKSITRAFDDDVEFQERMAEHIRYMVETIAHHQVDIDSE 137 SCOP domains ------------------------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------ Transcript 2uv1 A 60 QQLAREEKEAELADDMEKGIPQHLFESLCIDHLQRHGASKKSITRAFDDDVEFQERMAEHIRYMVETIAHHQVDIDSE 137 69 79 89 99 109 119 129 Chain B from PDB Type:PROTEIN Length:79 aligned with GAM_LAMBD | P03702 from UniProtKB/Swiss-Prot Length:138 Alignment length:79 68 78 88 98 108 118 128 GAM_LAMBD 59 YQQLAREEKEAELADDMEKGLPQHLFESLCIDHLQRHGASKKSITRAFDDDVEFQERMAEHIRYMVETIAHHQVDIDSE 137 SCOP domains ------------------------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------- Transcript 2uv1 B 59 YQQLAREEKEAELADDMEKGIPQHLFESLCIDHLQRHGASKKSITRAFDDDVEFQERMAEHIRYMVETIAHHQVDIDSE 137 68 78 88 98 108 118 128
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2UV1) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2UV1) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2UV1) |
Gene Ontology (3, 3)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (GAM_LAMBD | P03702)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|