Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF CHIMERIC VARIANT OF SH3 DOMAIN- SHH
 
Authors :  N. P. Kutyshenko, D. A. Prokhorov, M. A. Timchenko, Y. A. Kudrevatykh, L. V. Gushchina, V. S. Khristoforov, V. V. Filimonov
Date :  10 Apr 08  (Deposition) - 28 Apr 09  (Release) - 26 May 10  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Sh3, Chimeric Protein, Alpha-Spectrin, Actin Capping, Actin-Binding, Calcium, Calmodulin-Binding, Cytoplasm, Cytoskeleton, Phosphoprotein, Sh3 Domain, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  V. P. Kutyshenko, D. A. Prokhorov, M. A. Timchenko, Y. A. Kudrevatykh, L. V. Gushchina, V. S. Khristoforov, V. V. Filimonov, V. N. Uversky
Solution Structure And Dynamics Of The Chimeric Sh3 Domains, Shh- And Sha-"Bergeracs".
Biochim. Biophys. Acta V. 1794 1813 2009
PubMed-ID: 19732853  |  Reference-DOI: 10.1016/J.BBAPAP.2009.08.021
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - SPECTRIN ALPHA CHAIN, BRAIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 562
    Expression System Vector: PBAT-4
    Expression System Vector Type: VECTOR
    Fragment: ALPHA-SPECTRIN SH3 DOMAIN
    Gene: SPTAN1, SPTA2
    Organism Common: CHICKEN
    Organism Scientific: GALLUS GALLUS
    Organism Taxid: 9031
    Other Details: INSERTION OF BETA SHEET INCLUDING 47-56 RESIDUES (KITVNGKTYE) BETWEEN 47-48 OF SH3-PWT (1SHG).
    Synonym: SPECTRIN, NON-ERYTHROID ALPHA CHAIN, FODRIN ALPHA CHAIN

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2ROT)

(-) Sites  (0, 0)

(no "Site" information available for 2ROT)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2ROT)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2ROT)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2ROT)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SH3PS50002 Src homology 3 (SH3) domain profile.SPTN1_CHICK967-1026  1A:4-70

(-) Exons   (0, 0)

(no "Exon" information available for 2ROT)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:70
 aligned with SPTN1_CHICK | P07751 from UniProtKB/Swiss-Prot  Length:2477

    Alignment length:70
                                                                       1010     1011              
                                   973       983       993      1003      |  -     |1015      1025
         SPTN1_CHICK    964 DDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVN--------DRQGFVPAAYVKKLD 1025
               SCOP domains d2rota_ A: alpha-Spectrin, SH3 domain                                  SCOP domains
               CATH domains 2rotA00 A:1-70 SH3 Domains                                             CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeee..................eeeeee.....eeeeeeeeee..eeeeeeeeee...eee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---SH3  PDB: A:4-70 UniProt: 967-1026                                  PROSITE
                 Transcript ---------------------------------------------------------------------- Transcript
                2rot A    1 MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVKITVNGKTYERQGFVPAAYVKKLD   70
                                    10        20        30        40        50        60        70
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2ROT)

(-) Gene Ontology  (8, 8)

NMR Structure(hide GO term definitions)
Chain A   (SPTN1_CHICK | P07751)
molecular function
    GO:0003779    actin binding    Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0005516    calmodulin binding    Interacting selectively and non-covalently with calmodulin, a calcium-binding protein with many roles, both in the calcium-bound and calcium-free states.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0051693    actin filament capping    The binding of a protein or protein complex to the end of an actin filament, thus preventing the addition, exchange or removal of further actin subunits.
cellular component
    GO:0005938    cell cortex    The region of a cell that lies just beneath the plasma membrane and often, but not always, contains a network of actin filaments and associated proteins.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2rot)
 
  Sites
(no "Sites" information available for 2rot)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2rot)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2rot
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SPTN1_CHICK | P07751
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  SPTN1_CHICK | P07751
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SPTN1_CHICK | P07751: 1aey 1aj3 1bk2 1cun 1e6g 1e6h 1e7o 1g2b 1h8k 1hd3 1m8m 1neg 1pwt 1qkw 1qkx 1shg 1tuc 1tud 1u06 1u4q 1u5p 1uue 2cdt 2f2v 2f2w 2f2x 2jm8 2jm9 2jma 2jmc 2kr3 2kxd 2lj3 2nuz 2oaw 2rmo 3i9q 3m0p 3m0q 3m0r 3m0s 3m0t 3m0u 3ngp 4f16 4f17 5ihi 5ihk 5ihn 5m6s

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2ROT)