Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  RMP-PEPSTATIN A COMPLEX
 
Authors :  J. Yang, J. W. Quail
Date :  30 May 97  (Deposition) - 17 Sep 97  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.70
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Aspartic Proteinase, Pepstatin A, Aspartyl Protease-Peptide Complex, Hydrolase-Hydrolase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Yang, J. W. Quail
Structure Of The Rhizomucor Miehei Aspartic Proteinase Complexed With The Inhibitor Pepstatin A At 2. 7 A Resolution.
Acta Crystallogr. , Sect. D V. 55 625 1999
PubMed-ID: 10089458  |  Reference-DOI: 10.1107/S0907444998013961

(-) Compounds

Molecule 1 - MUCOROPEPSIN
    ChainsA
    EC Number3.4.23.23
    Organism CommonMUCOR MIEHEI
    Organism ScientificRHIZOMUCOR MIEHEI
    Organism Taxid4839
    SynonymMUCOR RENIN, RHIOMUCOR MIEHEI ASPARTIC PROTEINASE
 
Molecule 2 - PEPSTATIN
    ChainsB
    Organism ScientificSTREPTOMYCES
    Organism Taxid1883
    Other DetailsINHIBITOR PEPSTATIN A IS BOUND TO THE ENZYME
    Other Details - SourceSTREPTOMYCES (PEPSTATIN A WAS ISOLATED FROM STREPTOMYCES)

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 6)

Asymmetric/Biological Unit (4, 6)
No.NameCountTypeFull Name
1BMA1Ligand/IonBETA-D-MANNOSE
2IVA1Mod. Amino AcidISOVALERIC ACID
3NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
4STA2Mod. Amino AcidSTATINE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:5 , SER A:6 , VAL A:7 , ASP A:8 , THR A:9 , PRO A:10 , GLY A:11 , TYR A:12 , TYR A:13 , ASP A:14 , PHE A:15 , LEU A:17 , GLU A:18 , GLU A:19 , TYR A:20 , ALA A:21 , ILE A:22 , VAL A:24 , SER A:25 , ILE A:26 , GLY A:27 , PRO A:29 , GLY A:30 , LEU A:34 , LEU A:35 , LEU A:36 , PHE A:37 , ASP A:38 , THR A:39 , GLY A:40 , SER A:41 , SER A:42 , ASP A:43 , THR A:44 , TRP A:45 , VAL A:46 , PRO A:47 , HIS A:48 , CYS A:51 , GLU A:55 , GLY A:56 , VAL A:58 , GLY A:59 , ARG A:61 , PHE A:63 , SER A:66 , SER A:68 , SER A:69 , THR A:70 , PHE A:71 , LYS A:72 , THR A:74 , TYR A:76 , ASN A:77 , LEU A:78 , IVA B:700 , VAL B:701 , VAL B:702 , STA B:703 , ALA B:704 , STA B:705BINDING SITE FOR CHAIN A OF SUGAR BOUND TO ASN A 79 RESIDUES 79 TO 602
2AC2SOFTWAREGLU A:19 , LEU A:36 , ASP A:38 , GLY A:40 , TYR A:82 , GLY A:83 , THR A:84 , PRO A:117 , LEU A:132 , PHE A:210 , ASP A:237 , GLY A:239 , THR A:240 , ASN A:241 , LEU A:321 , ILE A:329BINDING SITE FOR CHAIN B OF PEPSTATIN

(-) SS Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1A:51 -A:57
2A:272 -A:316

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Thr A:28 -Pro A:29

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 1)

Asymmetric/Biological Unit (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_CARP_RHIMI_001 *G262SCARP_RHIMI  ---  ---AG193S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 3)

Asymmetric/Biological Unit (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PEPTIDASE_A1PS51767 Peptidase family A1 domain profile.CARP_RHIMI89-421  1A:20-352
2ASP_PROTEASEPS00141 Eukaryotic and viral aspartyl proteases active site.CARP_RHIMI104-115
303-314
  2A:35-46
A:234-245

(-) Exons   (0, 0)

(no "Exon" information available for 2RMP)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:358
 aligned with CARP_RHIMI | P00799 from UniProtKB/Swiss-Prot  Length:430

    Alignment length:358
                                    82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422        
           CARP_RHIMI    73 DGSVDTPGYYDFDLEEYAIPVSIGTPGQDFLLLFDTGSSDTWVPHKGCTKSEGCVGSRFFDPSASSTFKATNYNLNITYGTGGANGLYFEDSIAIGDITVTKQILAYVDNVRGPTAEQSPNADIFLDGLFGAAYPDNTAMEAEYGSTYNTVHVNLYKQGLISSPLFSVYMNTNSGTGEVVFGGVNNTLLGGDIAYTDVMSRYGGYYFWDAPVTGITVDGSAAVRFSRPQAFTIDTGTNFFIMPSSAASKIVKAALPDATETQQGWVVPCASYQNSKSTISIVMQKSGSSSDTIEISVPVSKMLLPVDQSNETCMFIILPDGGNQYIVGNLFLRFFVNVYDFGNNRIGFAPLASAYENE 430
               SCOP domains d2rmpa_ A: Acid protease                                                                                                                                                                                                                                                                                                                                               SCOP domains
               CATH domains --2rmpA01 A:6-186 Acid Proteases                                                                                                                                                       2rmpA02 A:187-359 Acid Proteases                                                                                                                                             -- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee...eeeeeeeee....eeeeeeee....eeeee.....hhhh........hhh....ee...eeeee....eeeeeeee.eeee..eeeeeeeeeeeeeee.hhhh..........eeee...hhhhhhhhhh......hhhhhhh........eeeeee...eeeeeee....hhh.....eeee...........eeeeeeeee...eeee....eeee.......eee.hhhhhhhhhhh....eee..eeeee..hhh....eeeeeee......eeeeeeeehhhh.eee.....eeee.eee......ee.hhhh..eeeeee....eeeeee..hhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ----------------PEPTIDASE_A1  PDB: A:20-352 UniProt: 89-421                                                                                                                                                                                                                                                                                                  --------- PROSITE (1)
                PROSITE (2) -------------------------------ASP_PROTEASE-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASP_PROTEASE-------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2rmp A   4 DGSVDTPGYYDFDLEEYAIPVSIGTPGQDFLLLFDTGSSDTWVPHKGCTKSEGCVGSRFFDPSASSTFKATNYNLNITYGTGGANGLYFEDSIAIGDITVTKQILAYVDNVRGPTAEQSPNADIFLDGLFGAAYPDNTAMEAEYGSTYNTVHVNLYKQGLISSPLFSVYMNTNSGTGEVVFGGVNNTLLGGDIAYTDVMSRYGGYYFWDAPVTGITVDGSAAVRFSRPQAFTIDTGTNFFIMPSSAASKIVKAALPDATETQQGWVVPCASYQNSKSTISIVMQKSGSSSDTIEISVPVSKMLLPVDQSNETCMFIILPDGGNQYIVGNLFLRFFVNVYDFGNNRIGFAPLASAYENE 361
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353        

Chain B from PDB  Type:PROTEIN  Length:6
                                      
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author ...... Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE ------ PROSITE
                 Transcript ------ Transcript
                 2rmp B 700 xVVxAx 705
                            |  | |
                          700-IVA|
                             703-STA
                               705-STA

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2RMP)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (CARP_RHIMI | P00799)
molecular function
    GO:0004190    aspartic-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which a water molecule bound by the side chains of aspartic residues at the active center acts as a nucleophile.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
biological process
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BMA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    IVA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    STA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Thr A:28 - Pro A:29   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2rmp
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CARP_RHIMI | P00799
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.23.23
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CARP_RHIMI | P00799
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CARP_RHIMI | P007992asi

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2RMP)