|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2RBI) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2RBI) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2RBI) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2RBI) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2RBI) |
Exons (0, 0)| (no "Exon" information available for 2RBI) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:108 aligned with RN_BACIN | P00649 from UniProtKB/Swiss-Prot Length:162 Alignment length:108 64 74 84 94 104 114 124 134 144 154 RN_BACIN 55 VINTFDGVADYLIRYKRLPDNYITKSQASALGWVASKGNLAEVAPGKSIGGDVFSNREGRLPSASGRTWREADINYVSGFRNADRLVYSSDWLIYKTTDHYATFTRIR 162 SCOP domains d2rbia_ A: Binase SCOP domains CATH domains 2rbiA00 A:2-109 [code=3.10.450.30, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------ Transcript 2rbi A 2 VINTFDGVADYLIRYKRLPDNYITKSQASALGWVASKGNLAEVAPGKSIGGDVFSNREGRLPSASGRTWREADINYVSGFRNADRLVYSSDWLIYKTTDNYATFTRIR 109 11 21 31 41 51 61 71 81 91 101 Chain B from PDB Type:PROTEIN Length:108 aligned with RN_BACIN | P00649 from UniProtKB/Swiss-Prot Length:162 Alignment length:108 64 74 84 94 104 114 124 134 144 154 RN_BACIN 55 VINTFDGVADYLIRYKRLPDNYITKSQASALGWVASKGNLAEVAPGKSIGGDVFSNREGRLPSASGRTWREADINYVSGFRNADRLVYSSDWLIYKTTDHYATFTRIR 162 SCOP domains d2rbib_ B: Binase SCOP domains CATH domains 2rbiB00 B:2-109 [code=3.10.450.30, no name defined] CATH domains Pfam domains (1) -----------------Ribonuclease-2rbiB01 B:19-108 - Pfam domains (1) Pfam domains (2) -----------------Ribonuclease-2rbiB02 B:19-108 - Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------ Transcript 2rbi B 2 VINTFDGVADYLIRYKRLPDNYITKSQASALGWVASKGNLAEVAPGKSIGGDVFSNREGRLPSASGRTWREADINYVSGFRNADRLVYSSDWLIYKTTDNYATFTRIR 109 11 21 31 41 51 61 71 81 91 101
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (10, 10)|
Asymmetric Unit(hide GO term definitions) Chain A,B (RN_BACIN | P00649)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|