Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE UNCHARACTERIZED PROTEIN YFEY FROM ESCHERICHIA COLI
 
Authors :  J. B. Bonanno, M. Gilmore, K. T. Bain, B. Wu, R. Romero, D. Smith, S. Wasse J. M. Sauder, S. K. Burley, S. C. Almo, New York Sgx Research Center Structural Genomics (Nysgxrc)
Date :  16 Aug 07  (Deposition) - 28 Aug 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Structural Genomics, Unknown Function, Psi-2, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Nysgxrc (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. B. Bonanno, M. Gilmore, K. T. Bain, B. Wu, R. Romero, D. Smith, S. Wasserman, J. M. Sauder, S. K. Burley, S. C. Almo
Crystal Structure Of The Uncharacterized Protein Yfey From Escherichia Coli.
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - UNCHARACTERIZED PROTEIN YFEY
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidMODIFIED PET26
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System VectorPET
    Expression System Vector TypePLASMID
    FragmentRESIDUES 28-191
    GeneYFEY, B2432, JW2425
    Organism ScientificESCHERICHIA COLI
    Organism Taxid83333
    StrainK12

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2QZB)

(-) Sites  (0, 0)

(no "Site" information available for 2QZB)

(-) SS Bonds  (2, 2)

Asymmetric Unit
No.Residues
1A:137 -A:150
2B:137 -B:150

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2QZB)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2QZB)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2QZB)

(-) Exons   (0, 0)

(no "Exon" information available for 2QZB)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:145
 aligned with YFEY_ECOLI | P76537 from UniProtKB/Swiss-Prot  Length:191

    Alignment length:153
                                    48        58        68        78        88        98       108       118       128       138       148       158       168       178       188   
           YFEY_ECOLI    39 TKVSEQGVGELTASTPLQEQAIADALDGDYRLRSGMKTANGNVVRFFEVMKGDNVAMVINGDQGTISRIDVLDSDIPADTGVKIGTPFSDLYSKAFGNCQKADGDDNRAVECKAEGSQHISYQFSGEWRGPEGLMPSDDTLKNWKVSKIIWRR 191
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2qzbA00 A:39-191 protein yfey like domain                                                                                                                 CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..ee..ee.........hhhhhhhhh....eeeeeeeee..eeeeeeeeee..eeeeeee.--....eeee...............hhhhhh......ee..------.eeee......eeeeee...........hhhhhh..eeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2qzb A  39 TKVSEQGVGELTASTPLQEQAIADALDGDYRLRSGMKTANGNVVRFFEVMKGDNVAMVING--GTISRIDVLDSDIPADTGVKIGTPFSDLYSKAFGNCQKA------AVECKAEGSQHISYQFSGEWRGPEGLMPSDDTLKNWKVSKIIWRR 191
                                    48        58        68        78        88        98|  |   108       118       128       138 |     148       158       168       178       188   
                                                                                       99  |                                   140    147                                            
                                                                                         102                                                                                         

Chain B from PDB  Type:PROTEIN  Length:147
 aligned with YFEY_ECOLI | P76537 from UniProtKB/Swiss-Prot  Length:191

    Alignment length:153
                                    48        58        68        78        88        98       108       118       128       138       148       158       168       178       188   
           YFEY_ECOLI    39 TKVSEQGVGELTASTPLQEQAIADALDGDYRLRSGMKTANGNVVRFFEVMKGDNVAMVINGDQGTISRIDVLDSDIPADTGVKIGTPFSDLYSKAFGNCQKADGDDNRAVECKAEGSQHISYQFSGEWRGPEGLMPSDDTLKNWKVSKIIWRR 191
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2qzbB00 B:39-191 protein y   fey like domain                                                                                                              CATH domains
           Pfam domains (1) DUF1131-2qzbB01 B:39-191                                                                                                                                  Pfam domains (1)
           Pfam domains (2) DUF1131-2qzbB02 B:39-191                                                                                                                                  Pfam domains (2)
         Sec.struct. author ..ee..ee..ee.....hhhhhhhhh---.eeeeeeeee..eeeeeeeeee..eeeeeeee.-..eeeeee...............hhhhhh......eee...--...eeee......eeeeee...........hhhhhh..eeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2qzb B  39 TKVSEQGVGELTASTPLQEQAIADAL---YRLRSGMKTANGNVVRFFEVMKGDNVAMVINGD-GTISRIDVLDSDIPADTGVKIGTPFSDLYSKAFGNCQKADG--NRAVECKAEGSQHISYQFSGEWRGPEGLMPSDDTLKNWKVSKIIWRR 191
                                    48        58     |  68        78        88        98 | |   108       118       128       138   |  |148       158       168       178       188   
                                                    64  68                             100 |                                     142  |                                              
                                                                                         102                                        145                                              

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2QZB)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 2)

Asymmetric Unit

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 2QZB)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2qzb)
 
  Sites
(no "Sites" information available for 2qzb)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2qzb)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2qzb
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  YFEY_ECOLI | P76537
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  YFEY_ECOLI | P76537
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2QZB)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2QZB)