|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)| Asymmetric/Biological Unit (2, 4) |
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (5, 5)
Asymmetric/Biological Unit
|
||||||||||||||||||||||||
Cis Peptide Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2QSK) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2QSK) |
Exons (0, 0)| (no "Exon" information available for 2QSK) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:95 aligned with SVN_SCYVA | P86041 from UniProtKB/Swiss-Prot Length:95 Alignment length:95 10 20 30 40 50 60 70 80 90 SVN_SCYVA 1 GSGPTYCWNEANNPGGPNRCSNNKQCDGARTCSSSGFCQGTSRKPDPGPKGPTYCWDEAKNPGGPNRCSNSKQCDGARTCSSSGFCQGTAGHAAA 95 SCOP domains ----------------------------------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------- Transcript 2qsk A 1 GSGPTYCWNEANNPGGPNRCSNNKQCDGARTCSSSGFCQGTSRKPDPGPKGPTYCWDEAKNPGGPNRCSNSKQCDGARTCSSSGFCQGTAGHAAA 95 10 20 30 40 50 60 70 80 90
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2QSK) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2QSK) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2QSK) |
Gene Ontology (3, 3)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (SVN_SCYVA | P86041)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|