|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (5, 13)| Asymmetric Unit (5, 13) Biological Unit 1 (5, 26) |
Sites (10, 10)
Asymmetric Unit (10, 10)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2Q9R) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2Q9R) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2Q9R) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2Q9R) |
Exons (0, 0)| (no "Exon" information available for 2Q9R) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:196 aligned with A3D7B7_SHEB5 | A3D7B7 from UniProtKB/TrEMBL Length:199 Alignment length:196 13 23 33 43 53 63 73 83 93 103 113 123 133 143 153 163 173 183 193 A3D7B7_SHEB5 4 KTGFFKRLKALTLPQKQLFATALCQRMLPNYQLFSEVCEFGDPAVLSTALELLWQSLYDPKLKFNIDVHLQRLEDNTPEPADFEAYGVYPAMDAVVAISTLLGAIQGKIEEDIVNISKLSSSTVANYIEAISDVDLVDEALDDFVFAHEVMEEEKELQNSLLEIIEENPKITAELVKGLRKDIIETGVSNIGISVA 199 SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains 2q9rA01 A:4-198 YP_001051499.1 domain like - CATH domains Pfam domains -DUF416-2q9rA01 A:5-198 - Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2q9r A 4 KTGFFKRLKALTLPQKQLFATALCQRmLPNYQLFSEVCEFGDPAVLSTALELLWQSLYDPKLKFNIDVHLQRLEDNTPEPADFEAYGVYPAmDAVVAISTLLGAIQGKIEEDIVNISKLSSSTVANYIEAISDVDLVDEALDDFVFAHEVmEEEKELQNSLLEIIEENPKITAELVKGLRKDIIETGVSNIGISVA 199 13 23 | 33 43 53 63 73 83 93 | 103 113 123 133 143 153| 163 173 183 193 30-MSE 95-MSE 154-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2Q9R) |
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2Q9R)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|