Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  TRYPANOSOMA CRUZI GLUCOKINASE IN COMPLEX WITH BETA-D-GLUCOSE AND ADP
 
Authors :  A. T. Cordeiro, A. J. Caceres, D. Vertommen, J. L. Concepcion, P. A. Mich W. Versees
Date :  29 May 07  (Deposition) - 16 Oct 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Atpase Hexose Kinase Family, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. T. Cordeiro, A. J. Caceres, D. Vertommen, J. L. Concepcion, P. A. Michels, W. Versees
The Crystal Structure Of Trypanosoma Cruzi Glucokinase Reveals Features Determining Oligomerization And Anomer Specificity Of Hexose-Phosphorylating Enzymes.
J. Mol. Biol. V. 372 1215 2007
PubMed-ID: 17761195  |  Reference-DOI: 10.1016/J.JMB.2007.07.021

(-) Compounds

Molecule 1 - GLUCOKINASE 1, PUTATIVE
    Chains: A, B
    EC Number: 2.7.1.2
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21
    Expression System Plasmid: PET28
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Expression System Vector Type: PLASMID
    Gene: TC00.1047053510187.100
    Organism Scientific: TRYPANOSOMA CRUZI
    Organism Taxid: 5693

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 4)

Asymmetric/Biological Unit (2, 4)
No.NameCountTypeFull Name
1ADP2Ligand/IonADENOSINE-5'-DIPHOSPHATE
2BGC2Ligand/IonBETA-D-GLUCOSE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREPRO A:92 , GLY A:93 , ASN A:105 , ASN A:130 , ASP A:131 , GLY A:186 , GLY A:188 , GLU A:207 , GLU A:236 , HOH A:2013 , HOH A:2037 , HOH A:2137 , HOH A:2187BINDING SITE FOR RESIDUE BGC A 1001
2AC2SOFTWAREPRO B:92 , GLY B:93 , PRO B:94 , ASN B:105 , ASN B:130 , ASP B:131 , LEU B:187 , GLY B:188 , GLU B:207 , GLU B:236 , HOH B:2040 , HOH B:2125 , HOH B:2203BINDING SITE FOR RESIDUE BGC B 1001
3AC3SOFTWAREGLY A:184 , THR A:185 , GLY A:241 , ALA A:261 , ALA A:265 , ASN A:308 , ASN A:312 , HOH A:2033 , HOH A:2037 , HOH A:2069 , HOH A:2071 , HOH A:2107 , HOH A:2145 , HOH A:2154 , HOH A:2204 , HOH A:2223 , HOH A:2228BINDING SITE FOR RESIDUE ADP A 2001
4AC4SOFTWAREGLY B:184 , THR B:185 , ALA B:261 , ALA B:265 , ASN B:308 , ASN B:312 , HOH B:2008 , HOH B:2023 , HOH B:2045 , HOH B:2087 , HOH B:2088 , HOH B:2115 , HOH B:2116 , HOH B:2199 , HOH B:2232BINDING SITE FOR RESIDUE ADP B 2001

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2Q2R)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Gly A:102 -Pro A:103
2Gly B:102 -Pro B:103

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2Q2R)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2Q2R)

(-) Exons   (0, 0)

(no "Exon" information available for 2Q2R)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:370
 aligned with Q4E4E1_TRYCC | Q4E4E1 from UniProtKB/TrEMBL  Length:376

    Alignment length:373
                                  1                                                                                                                                                                                                                                                                                                                                                                              
                                  |  4        14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364   
         Q4E4E1_TRYCC     - ------MNIKELSLHELCEELKTPAWNVPLTFVGDVGGTSARMGFVREGKNDSVHACVTRYSMKRKDITELIEFFNEIIELMPASVIKRVKAGVINVPGPVTGGAVGGPFNNLKGIARLSDYPKALFPPGRSAILNDLEAGGFGVLAVSDAHVFSEYFGVMWEGTQWRTCEQEPAGSVIGRGRCLVLAPGTGLGSSLIYYNPMNQQHIVVPLELGSQTIPMRKDIDYIQTLHAELKLLPNYENMVSGAGLEFHYRQVVRGSRPPCSAGEIAKLASEGDANACKAMKKYHEYLMRVGSEASMALLPLTIVLVGDNIVNNAFFYRNPQNLKEMHREALNHEMERFGFQSRVTYLRQKKLLNLNLMGCYRCGLDLS 367
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeee.hhhhhhhhhhhhhhh..eeeeeee...eeeeeeeee.hhh.eeeeeeeee....hhhhhhhhhhhhhhhhhhhhhh.eeeeeeee...ee...ee.........ee.hhh.........eeeeehhhhhhhhhhhhhhh.hhhhheeeee.....................eeeeee...eeeeeeee..---.eeeeeehhhhh......hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh..eeee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhheeeee....hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2q2r A  -5 APAGSHMNIKELSLHELCEELKTPAWNAPLTFVGDVGGTSARMGFVREGKNDSVHACVTRYSMKRKDITEIIEFFNEIIELMPASVMKRVKAGVINVPGPVTGGAVGGPFNNLKGIARLSDYPKALFPPGHSAILNDLEAGGFGVLAVSDAHVFSEYFGVMWEGTQWRTCEQEPAGSVIGRGRCLVLAPGTGLGSSLIYYNP---QHIVVPLELGSQTLPMRKDIDYIQTLHAELKLFPNYENMVSGAGLEFHYRQVVRGSRPPCSAGEIAKLASEGDANACKAMKKYHEYLMRVGSEASMALLPLTIVLVGDNIVNNAFFYRNPQNLKEMHHEALNHEMERFGFQSRVSYLRQKKLLNLNLMGCYRCGLDLS 367
                                     4        14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194 |   | 204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364   
                                                                                                                                                                                                                                   196 200                                                                                                                                                                       


Chain B from PDB  Type:PROTEIN  Length:370
 aligned with Q4E4E1_TRYCC | Q4E4E1 from UniProtKB/TrEMBL  Length:376

    Alignment length:373
                                  1                                                                                                                                                                                                                                                                                                                                                                              
                                  |  4        14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364   
         Q4E4E1_TRYCC     - ------MNIKELSLHELCEELKTPAWNVPLTFVGDVGGTSARMGFVREGKNDSVHACVTRYSMKRKDITELIEFFNEIIELMPASVIKRVKAGVINVPGPVTGGAVGGPFNNLKGIARLSDYPKALFPPGRSAILNDLEAGGFGVLAVSDAHVFSEYFGVMWEGTQWRTCEQEPAGSVIGRGRCLVLAPGTGLGSSLIYYNPMNQQHIVVPLELGSQTIPMRKDIDYIQTLHAELKLLPNYENMVSGAGLEFHYRQVVRGSRPPCSAGEIAKLASEGDANACKAMKKYHEYLMRVGSEASMALLPLTIVLVGDNIVNNAFFYRNPQNLKEMHREALNHEMERFGFQSRVTYLRQKKLLNLNLMGCYRCGLDLS 367
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeee.hhhhhhhhhhhhhhh..eeeeeee...eeeeeeeee.hhh.eeeeeeeee......hhhhhhhhhhhhhhhhhhhh.eeeeeeee...ee...ee.........ee.hhh.........eeeeehhhhhhhhhhhhhhh.hhhhheeeee...hhhhhh............eeeeee...eeeeeeee..---.eeeee.hhhhh......hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh..eeee.hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhh.....eeeee....hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2q2r B  -5 APAGSHMNIKELSLHELCEELKTPAWNAPLTFVGDVGGTSARMGFVREGKNDSVHACVTRYSMKRKDITEIIEFFNEIIELMPASVMKRVKAGVINVPGPVTGGAVGGPFNNLKGIARLSDYPKALFPPGHSAILNDLEAGGFGVLAVSDAHVFSEYFGVMWEGTQWRTCEQEPAGSVIGRGRCLVLAPGTGLGSSLIYYNP---QHIVVPLELGSQTLPMRKDIDYIQTLHAELKLFPNYENMVSGAGLEFHYRQVVRGSRPPCSAGEIAKLASEGDANACKAMKKYHEYLMRVGSEASMALLPLTIVLVGDNIVNNAFFYRNPQNLKEMHHEALNHEMERFGFQSRVSYLRQKKLLNLNLMGCYRCGLDLS 367
                                     4        14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194 |   | 204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364   
                                                                                                                                                                                                                                   196 200
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2Q2R)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2Q2R)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2Q2R)

(-) Gene Ontology  (8, 8)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q4E4E1_TRYCC | Q4E4E1)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0004340    glucokinase activity    Catalysis of the reaction: ATP + D-glucose = ADP + D-glucose-6-phosphate.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0051156    glucose 6-phosphate metabolic process    The chemical reactions and pathways involving glucose 6-phosphate, a monophosphorylated derivative of glucose with the phosphate group attached to C-6.
    GO:0006096    glycolytic process    The chemical reactions and pathways resulting in the breakdown of a carbohydrate into pyruvate, with the concomitant production of a small amount of ATP and the reduction of NAD(P) to NAD(P)H. Glycolysis begins with the metabolism of a carbohydrate to generate products that can enter the pathway and ends with the production of pyruvate. Pyruvate may be converted to acetyl-coenzyme A, ethanol, lactate, or other small molecules.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ADP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    BGC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:102 - Pro A:103   [ RasMol ]  
    Gly B:102 - Pro B:103   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2q2r
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q4E4E1_TRYCC | Q4E4E1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.7.1.2
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q4E4E1_TRYCC | Q4E4E1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q4E4E1_TRYCC | Q4E4E1: 5brd 5bre 5brf 5brh

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2Q2R)