Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE BORDETELLA BRONCHISEPTICA ENZYME WBMH IN COMPLEX WITH NAD+
 
Authors :  J. D. King, N. J. Harmer, D. J. Maskell, T. L. Blundell
Date :  25 May 07  (Deposition) - 02 Oct 07  (Release) - 12 Nov 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.19
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  B,C  (1x)
Biol. Unit 2:  A  (2x)
Keywords :  Rossmann Fold, Protein-Nad Complex, Sugar Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. D. King, N. J. Harmer, A. Preston, C. M. Palmer, M. Rejzek, R. A. Field T. L. Blundell, D. J. Maskell
Predicting Protein Function From Structure--The Roles Of Short-Chain Dehydrogenase/Reductase Enzymes In Bordetella O-Antigen Biosynthesis.
J. Mol. Biol. V. 374 749 2007
PubMed-ID: 17950751  |  Reference-DOI: 10.1016/J.JMB.2007.09.055
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PUTATIVE NUCLEOTIDE SUGAR EPIMERASE/ DEHYDRATASE
    ChainsA, B, C
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET15B
    Expression System StrainBL21 (DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneBBLPS1.14, WBMH
    Organism ScientificBORDETELLA BRONCHISEPTICA
    Organism Taxid518

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit ABC
Biological Unit 1 (1x) BC
Biological Unit 2 (2x)A  

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 3)

Asymmetric Unit (1, 3)
No.NameCountTypeFull Name
1NAD3Ligand/IonNICOTINAMIDE-ADENINE-DINUCLEOTIDE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1NAD2Ligand/IonNICOTINAMIDE-ADENINE-DINUCLEOTIDE
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1NAD2Ligand/IonNICOTINAMIDE-ADENINE-DINUCLEOTIDE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:8 , CYS A:10 , GLY A:11 , GLN A:12 , ILE A:13 , ASP A:32 , ASN A:33 , PHE A:34 , ALA A:35 , THR A:36 , GLY A:37 , GLY A:53 , SER A:54 , ILE A:55 , THR A:76 , ALA A:77 , ALA A:78 , TYR A:80 , THR A:92 , PHE A:115 , TYR A:143 , LYS A:147 , ASN A:168 , VAL A:169 , HOH A:505 , HOH A:510 , HOH A:528 , HOH A:544BINDING SITE FOR RESIDUE NAD A 501
2AC2SOFTWAREGLY B:8 , CYS B:10 , GLY B:11 , GLN B:12 , ILE B:13 , ASP B:32 , ASN B:33 , PHE B:34 , ALA B:35 , THR B:36 , GLY B:37 , GLY B:53 , SER B:54 , ILE B:55 , THR B:76 , ALA B:77 , ALA B:78 , TYR B:80 , THR B:92 , PHE B:115 , GLN B:116 , TYR B:143 , LYS B:147 , ALA B:167 , ASN B:168 , VAL B:169 , HOH B:503 , HOH B:504 , HOH B:548BINDING SITE FOR RESIDUE NAD B 501
3AC3SOFTWAREGLY C:8 , CYS C:10 , GLY C:11 , GLN C:12 , ILE C:13 , ASP C:32 , ASN C:33 , PHE C:34 , ALA C:35 , THR C:36 , GLY C:37 , GLY C:53 , SER C:54 , ILE C:55 , THR C:76 , ALA C:77 , ALA C:78 , TYR C:80 , THR C:92 , PHE C:115 , GLN C:116 , TYR C:143 , LYS C:147 , LEU C:166 , ASN C:168 , VAL C:169 , HOH C:507 , HOH C:513 , HOH C:516BINDING SITE FOR RESIDUE NAD C 501

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2Q1W)

(-) Cis Peptide Bonds  (3, 3)

Asymmetric Unit
No.Residues
1Gln A:128 -Pro A:129
2Gln B:128 -Pro B:129
3Gln C:128 -Pro C:129

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2Q1W)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2Q1W)

(-) Exons   (0, 0)

(no "Exon" information available for 2Q1W)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:300
 aligned with O87987_BORBO | O87987 from UniProtKB/TrEMBL  Length:313

    Alignment length:300
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300
         O87987_BORBO     1 MKKVFITGICGQIGSHIAELLLERGDKVVGIDNFATGRREHLKDHPNLTFVEGSIADHALVNQLIGDLQPDAVVHTAASYKDPDDWYNDTLTNCVGGSNVVQAAKKNNVGRFVYFQTALCYGVKPIQQPVRLDHPRNPANSSYAISKSANEDYLEYSGLDFVTFRLANVVGPRNVSGPLPIFFQRLSEGKKCFVTKARRDFVFVKDLARATVRAVDGVGHGAYHFSSGTDVAIKELYDAVVEAMALPSYPEPEIRELGPDDAPSILLDPSRTIQDFGKIEFTPLKETVAAAVAYFREYGV 300
               SCOP domains d2q1wa_ A: automated matches                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeee...hhhhhhhhhhhhhh..eeeeee.....hhhhh.....eeeee....hhhhhhhhhhhhh..eeee.........hhhhhhhhhhhhhhhhhhhhhhh...eeeeeee.hhhh..................hhhhhhhhhhhhhhhhhh..eeeeee.eee......hhhhhhhhhhhh....eeee.ee.eeehhhhhhhhhhhhh....eeee......eehhhhhhhhhhhh........eeee............hhhhhhhhh.....hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2q1w A   1 MKKVFITGICGQIGSHIAELLLERGDKVVGIDNFATGRREHLKDHPNLTFVEGSIADHALVNQLIGDLQPDAVVHTAASYKDPDDWYNDTLTNCVGGSNVVQAAKKNNVGRFVYFQTALCYGVKPIQQPVRLDHPRNPANSSYAISKSANEDYLEYSGLDFVTFRLANVVGPRNVSGPLPIFFQRLSEGKKCFVTKARRDFVFVKDLARATVRAVDGVGHGAYHFSSGTDVAIKELYDAVVEAMALPSYPEPEIRELGPDDAPSILLDPSRTIQDFGKIEFTPLKETVAAAVAYFREYGV 300
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300

Chain B from PDB  Type:PROTEIN  Length:299
 aligned with O87987_BORBO | O87987 from UniProtKB/TrEMBL  Length:313

    Alignment length:301
                             1                                                                                                                                                                                                                                                                                                           
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299 
         O87987_BORBO     - -MKKVFITGICGQIGSHIAELLLERGDKVVGIDNFATGRREHLKDHPNLTFVEGSIADHALVNQLIGDLQPDAVVHTAASYKDPDDWYNDTLTNCVGGSNVVQAAKKNNVGRFVYFQTALCYGVKPIQQPVRLDHPRNPANSSYAISKSANEDYLEYSGLDFVTFRLANVVGPRNVSGPLPIFFQRLSEGKKCFVTKARRDFVFVKDLARATVRAVDGVGHGAYHFSSGTDVAIKELYDAVVEAMALPSYPEPEIRELGPDDAPSILLDPSRTIQDFGKIEFTPLKETVAAAVAYFREYGV 300
               SCOP domains d2q1wb_ B: automated matches                                                                                                                                                                                                                                                                                  SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee...hhhhhhhhhhhhhh..eeeeee.....hhhhh.....eeeee....hhhhhhhhhhhhh..eeee.........hhhhhhhhhhhhhhhhhhhhhhh...eeeeeee.hhhh..................hhhhhhhhhhhhhhhhhh..eeeeee.eee......hhhhhhhhhhhhh...eee..ee.eeehhhhhhhhhhhhh....eeee......eehhhhhhhhhhhhh.......eee..--.........hhhhhhhhh.....hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2q1w B   0 HMKKVFITGICGQIGSHIAELLLERGDKVVGIDNFATGRREHLKDHPNLTFVEGSIADHALVNQLIGDLQPDAVVHTAASYKDPDDWYNDTLTNCVGGSNVVQAAKKNNVGRFVYFQTALCYGVKPIQQPVRLDHPRNPANSSYAISKSANEDYLEYSGLDFVTFRLANVVGPRNVSGPLPIFFQRLSEGKKCFVTKARRDFVFVKDLARATVRAVDGVGHGAYHFSSGTDVAIKELYDAVVEAMALPSYPEPEIREL--DDAPSILLDPSRTIQDFGKIEFTPLKETVAAAVAYFREYGV 300
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       | -|      269       279       289       299 
                                                                                                                                                                                                                                                                                           257  |                                        
                                                                                                                                                                                                                                                                                              260                                        

Chain C from PDB  Type:PROTEIN  Length:296
 aligned with O87987_BORBO | O87987 from UniProtKB/TrEMBL  Length:313

    Alignment length:300
                             1                                                                                                                                                                                                                                                                                                          
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299
         O87987_BORBO     - -MKKVFITGICGQIGSHIAELLLERGDKVVGIDNFATGRREHLKDHPNLTFVEGSIADHALVNQLIGDLQPDAVVHTAASYKDPDDWYNDTLTNCVGGSNVVQAAKKNNVGRFVYFQTALCYGVKPIQQPVRLDHPRNPANSSYAISKSANEDYLEYSGLDFVTFRLANVVGPRNVSGPLPIFFQRLSEGKKCFVTKARRDFVFVKDLARATVRAVDGVGHGAYHFSSGTDVAIKELYDAVVEAMALPSYPEPEIRELGPDDAPSILLDPSRTIQDFGKIEFTPLKETVAAAVAYFREYG 299
               SCOP domains d2q1wc_ C: automated matches                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee...hhhhhhhhhhhhhh..eeeeee.....hhhhh.....eeeee....hhhhhhhhhhhhh..eeee.........hhhhhhhhhhhhhhhhhhhhhhh...eeeeeee.hhhh..................hhhhhhhhhhhhhhhhhh..eeeeee..ee....-.hhhhhhhhhhhh....eee..ee..eehhhhhhhhhhhhh....eeee......eehhhhhhhhhhhhh.......eee...---.......hhhhhhhhh.....hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2q1w C   0 HMKKVFITGICGQIGSHIAELLLERGDKVVGIDNFATGRREHLKDHPNLTFVEGSIADHALVNQLIGDLQPDAVVHTAASYKDPDDWYNDTLTNCVGGSNVVQAAKKNNVGRFVYFQTALCYGVKPIQQPVRLDHPRNPANSSYAISKSANEDYLEYSGLDFVTFRLANVVGPRN-SGPLPIFFQRLSEGKKCFVTKARRDFVFVKDLARATVRAVDGVGHGAYHFSSGTDVAIKELYDAVVEAMALPSYPEPEIRELG---APSILLDPSRTIQDFGKIEFTPLKETVAAAVAYFREYG 299
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169    | |179       189       199       209       219       229       239       249        |-  |    269       279       289       299
                                                                                                                                                                                                        174 |                                                                               258 262                                     
                                                                                                                                                                                                          176                                                                                                                           

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2Q1W)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2Q1W)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C   (O87987_BORBO | O87987)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0050662    coenzyme binding    Interacting selectively and non-covalently with a coenzyme, any of various nonprotein organic cofactors that are required, in addition to an enzyme and a substrate, for an enzymatic reaction to proceed.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0006541    glutamine metabolic process    The chemical reactions and pathways involving glutamine, 2-amino-4-carbamoylbutanoic acid.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gln A:128 - Pro A:129   [ RasMol ]  
    Gln B:128 - Pro B:129   [ RasMol ]  
    Gln C:128 - Pro C:129   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2q1w
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  O87987_BORBO | O87987
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  O87987_BORBO | O87987
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2Q1W)

(-) Related Entries Specified in the PDB File

2pzk CLOSEST KNOWN HOMOLOGUE, USED AS A SEARCH MODEL FOR MOLECULAR REPLACEMENT.