Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  STRUCTURE AND REARRANGEMENTS IN THE CARBOXY-TERMINAL REGION OF SPIH CHANNELS
 
Authors :  G. E. Flynn, K. D. Black, L. D. Islas, B. Sankaran, W. N. Zagotta
Date :  21 May 07  (Deposition) - 19 Jun 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.25
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (4x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  A (4x),B (4x)
Biol. Unit 4:  B  (4x)
Keywords :  Hcn2, Ion Channel, Cyclic Nucleotide Binding Domain, C-Linker, Cgmp, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. E. Flynn, K. D. Black, L. D. Islas, B. Sankaran, W. N. Zagotta
Structure And Rearrangements In The Carboxy-Terminal Region Of Spih Channels.
Structure V. 15 671 2007
PubMed-ID: 17562314  |  Reference-DOI: 10.1016/J.STR.2007.04.008

(-) Compounds

Molecule 1 - POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED CYCLIC NUCLEOTIDE-GATED CHANNEL 2
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPHMALC2T
    Expression System StrainBL-21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentC-TERMINAL DOMAIN (RESIDUES 443-640)
    GeneHCN2, BCNG2, HAC1
    MutationYES
    Organism CommonHOUSE MOUSE
    Organism ScientificMUS MUSCULUS
    Organism Taxid10090
    SynonymBRAIN CYCLIC NUCLEOTIDE-GATED CHANNEL 2, BCNG-2, HYPERPOLARIZATION-ACTIVATED CATION CHANNEL 1, HAC-1

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (4x)A 
Biological Unit 2 (1x) B
Biological Unit 3 (4x)A (4x)B (4x)
Biological Unit 4 (4x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1PCG2Ligand/IonCYCLIC GUANOSINE MONOPHOSPHATE
Biological Unit 1 (1, 4)
No.NameCountTypeFull Name
1PCG4Ligand/IonCYCLIC GUANOSINE MONOPHOSPHATE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1PCG1Ligand/IonCYCLIC GUANOSINE MONOPHOSPHATE
Biological Unit 3 (1, 4)
No.NameCountTypeFull Name
1PCG4Ligand/IonCYCLIC GUANOSINE MONOPHOSPHATE
Biological Unit 4 (1, 4)
No.NameCountTypeFull Name
1PCG4Ligand/IonCYCLIC GUANOSINE MONOPHOSPHATE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHOH A:163 , MET A:572 , PHE A:580 , GLY A:581 , GLU A:582 , ILE A:583 , CYS A:584 , ARG A:591 , THR A:592 , ALA A:593 , ARG A:632 , ASP A:636BINDING SITE FOR RESIDUE PCG A 401
2AC2SOFTWAREMET B:572 , PHE B:580 , GLY B:581 , GLU B:582 , ILE B:583 , CYS B:584 , ARG B:591 , THR B:592 , ALA B:593 , ARG B:632 , ASP B:636BINDING SITE FOR RESIDUE PCG B 402

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2Q0A)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2Q0A)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2Q0A)

(-) PROSITE Motifs  (2, 4)

Asymmetric Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CNMP_BINDING_3PS50042 cAMP/cGMP binding motif profile.HCN2_MOUSE517-623
 
  2A:517-623
B:517-623
2CNMP_BINDING_1PS00888 Cyclic nucleotide-binding domain signature 1.HCN2_MOUSE544-560
 
  2A:544-560
B:544-560
Biological Unit 1 (2, 8)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CNMP_BINDING_3PS50042 cAMP/cGMP binding motif profile.HCN2_MOUSE517-623
 
  4A:517-623
-
2CNMP_BINDING_1PS00888 Cyclic nucleotide-binding domain signature 1.HCN2_MOUSE544-560
 
  4A:544-560
-
Biological Unit 2 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CNMP_BINDING_3PS50042 cAMP/cGMP binding motif profile.HCN2_MOUSE517-623
 
  1-
B:517-623
2CNMP_BINDING_1PS00888 Cyclic nucleotide-binding domain signature 1.HCN2_MOUSE544-560
 
  1-
B:544-560
Biological Unit 3 (2, 16)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CNMP_BINDING_3PS50042 cAMP/cGMP binding motif profile.HCN2_MOUSE517-623
 
  8A:517-623
B:517-623
2CNMP_BINDING_1PS00888 Cyclic nucleotide-binding domain signature 1.HCN2_MOUSE544-560
 
  8A:544-560
B:544-560
Biological Unit 4 (2, 8)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CNMP_BINDING_3PS50042 cAMP/cGMP binding motif profile.HCN2_MOUSE517-623
 
  4-
B:517-623
2CNMP_BINDING_1PS00888 Cyclic nucleotide-binding domain signature 1.HCN2_MOUSE544-560
 
  4-
B:544-560

(-) Exons   (4, 8)

Asymmetric Unit (4, 8)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSMUST000000995131ENSMUSE00000332759chr10:79179379-79179964586HCN2_MOUSE1-1841840--
1.2ENSMUST000000995132ENSMUSE00000574999chr10:79187133-79187556424HCN2_MOUSE184-3251420--
1.3ENSMUST000000995133ENSMUSE00000574998chr10:79188892-79189053162HCN2_MOUSE326-379540--
1.4ENSMUST000000995134ENSMUSE00000574997chr10:79191638-79191856219HCN2_MOUSE380-452732A:443-452
B:443-452
10
10
1.5ENSMUST000000995135ENSMUSE00000574996chr10:79193592-79193738147HCN2_MOUSE453-501492A:453-501
B:453-501
49
49
1.6ENSMUST000000995136ENSMUSE00000574995chr10:79196416-79196656241HCN2_MOUSE502-582812A:502-582
B:502-582
81
81
1.7ENSMUST000000995137ENSMUSE00000574994chr10:79196808-79196972165HCN2_MOUSE582-637562A:582-636
B:582-636
55
55
1.8bENSMUST000000995138bENSMUSE00000642019chr10:79197603-791988531251HCN2_MOUSE637-8632270--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:194
 aligned with HCN2_MOUSE | O88703 from UniProtKB/Swiss-Prot  Length:863

    Alignment length:194
                                   452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632    
           HCN2_MOUSE   443 DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRI 636
               SCOP domains d2q0aa_ A: HCN pacemaker channel                                                                                                                                                                   SCOP domains
               CATH domains 2q0aA01 A:443-508 Helix hairpin bin                               2q0aA02 A:509-636 Jelly Rolls                                                                                                    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhh.eeeee....eee.......eeeeeee.eeeee.......eee...eehhhhhhhh.....eeee...eeeeeeehhhhhhhhh.hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------------------------------------------------------------------------CNMP_BINDING_3  PDB: A:517-623 UniProt: 517-623                                                            ------------- PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------------------------------CNMP_BINDING_1   ---------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.4  Exon 1.5  PDB: A:453-501 UniProt: 453-501        Exon 1.6  PDB: A:502-582 UniProt: 502-582                                        ------------------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------------------------------------------------------------------------------Exon 1.7  PDB: A:582-636 UniProt: 582-637 [INCOMPLETE]  Transcript 1 (2)
                 2q0a A 443 DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRD 636
                                   452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632    

Chain B from PDB  Type:PROTEIN  Length:194
 aligned with HCN2_MOUSE | O88703 from UniProtKB/Swiss-Prot  Length:863

    Alignment length:194
                                   452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632    
           HCN2_MOUSE   443 DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRI 636
               SCOP domains d2q0ab_ B: HCN pacemaker channel                                                                                                                                                                   SCOP domains
               CATH domains 2q0aB01 B:443-508 Helix hairpin bin                               2q0aB02 B:509-636 Jelly Rolls                                                                                                    CATH domains
           Pfam domains (1) --------------------------------------------------------------------------------------------cNMP_binding-2q0aB01 B:535-620                                                        ---------------- Pfam domains (1)
           Pfam domains (2) --------------------------------------------------------------------------------------------cNMP_binding-2q0aB02 B:535-620                                                        ---------------- Pfam domains (2)
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeee....eee.......eeeeeee..eeee.......ee....eehhhhhhhh.....eeee...eeeeeeehhhhhhhhh.hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------------------------------------------------------------------------CNMP_BINDING_3  PDB: B:517-623 UniProt: 517-623                                                            ------------- PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------------------------------CNMP_BINDING_1   ---------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.4  Exon 1.5  PDB: B:453-501 UniProt: 453-501        Exon 1.6  PDB: B:502-582 UniProt: 502-582                                        ------------------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------------------------------------------------------------------------------Exon 1.7  PDB: B:582-636 UniProt: 582-637 [INCOMPLETE]  Transcript 1 (2)
                 2q0a B 443 DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRD 636
                                   452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (2, 4)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 2)

Asymmetric Unit

(-) Gene Ontology  (27, 27)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (HCN2_MOUSE | O88703)
molecular function
    GO:0030552    cAMP binding    Interacting selectively and non-covalently with cAMP, the nucleotide cyclic AMP (adenosine 3',5'-cyclophosphate).
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005222    intracellular cAMP activated cation channel activity    Enables the transmembrane transfer of a cation by a channel that opens when intracellular cAMP has been bound by the channel complex or one of its constituent parts.
    GO:0005216    ion channel activity    Enables the facilitated diffusion of an ion (by an energy-independent process) by passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism. May be either selective (it enables passage of a specific ion only) or non-selective (it enables passage of two or more ions of same charge but different size).
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005267    potassium channel activity    Enables the facilitated diffusion of a potassium ion (by an energy-independent process) involving passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0005272    sodium channel activity    Enables the facilitated diffusion of a sodium ion (by an energy-independent process) involving passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism.
    GO:0005244    voltage-gated ion channel activity    Enables the transmembrane transfer of an ion by a voltage-gated channel. An ion is an atom or group of atoms carrying an electric charge by virtue of having gained or lost one or more electrons. A voltage-gated channel is a channel whose open state is dependent on the voltage across the membrane in which it is embedded.
    GO:0005249    voltage-gated potassium channel activity    Enables the transmembrane transfer of a potassium ion by a voltage-gated channel. A voltage-gated channel is a channel whose open state is dependent on the voltage across the membrane in which it is embedded.
    GO:0005248    voltage-gated sodium channel activity    Enables the transmembrane transfer of a sodium ion by a voltage-gated channel. A voltage-gated channel is a channel whose open state is dependent on the voltage across the membrane in which it is embedded.
biological process
    GO:0071320    cellular response to cAMP    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate) stimulus.
    GO:0071321    cellular response to cGMP    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cGMP (cyclic GMP, guanosine 3',5'-cyclophosphate) stimulus.
    GO:0006811    ion transport    The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0071805    potassium ion transmembrane transport    A process in which a potassium ion is transported from one side of a membrane to the other.
    GO:0006813    potassium ion transport    The directed movement of potassium ions (K+) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0034765    regulation of ion transmembrane transport    Any process that modulates the frequency, rate or extent of the directed movement of ions from one side of a membrane to the other.
    GO:0042391    regulation of membrane potential    Any process that modulates the establishment or extent of a membrane potential, the electric potential existing across any membrane arising from charges in the membrane itself and from the charges present in the media on either side of the membrane.
    GO:0060078    regulation of postsynaptic membrane potential    Any process that modulates the potential difference across a post-synaptic membrane.
    GO:0035725    sodium ion transmembrane transport    A process in which a sodium ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
    GO:0006814    sodium ion transport    The directed movement of sodium ions (Na+) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0055085    transmembrane transport    The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    PCG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2q0a)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2q0a
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HCN2_MOUSE | O88703
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  HCN2_MOUSE | O88703
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HCN2_MOUSE | O887031q3e 1q43 1q5o 3bpz 3etq 3ffq 4eqf 5jon 5khg 5khh 5khi 5khj 5khk

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2Q0A)