2Q05 - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF TYR/SER PROTEIN PHOSPHATASE FROM VACCINIA VIRUS WR

Authors :   J. Osipiuk, T. Skarina, O. Kagan, A. Savchenko, A. Edwards, A. Joachimi Midwest Center For Structural Genomics (Mcsg)

Date :   18 May 07 (Deposition) - 19 Jun 07 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.57

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B,C,D  (3x)

Keywords :   Phosphatase, Vaccinia Virus, Structural Genomics, Apc7320, Psi-2, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Osipiuk, T. Skarina, O. Kagan, A. Savchenko, A. Edwards, A. Joachimiak
Crystal Structure Of Tyr/Ser Protein Phosphatase From Vaccinia Virus Wr.
To Be Published
PubMed: search

Molecule 1 - DUAL SPECIFICITY PROTEIN PHOSPHATASE
	Chains	:	A, B, C, D
	EC Number	:	3.1.3.48, 3.1.3.16
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PET15B
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	H1L, VACWR099
	Organism Scientific	:	VACCINIA VIRUS WR
	Organism Taxid	:	10254
	Strain	:	WR (WESTERN RESERVE), VACV
	Synonym	:	LATE PROTEIN H1

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (3x)	:	A	B	C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 36)

No.	Name	Count	Type	Full Name
1	MSE	36	Mod. Amino Acid	SELENOMETHIONINE

Biological Unit 1 (1, 108)

No.	Name	Count	Type	Full Name
1	MSE	108	Mod. Amino Acid	SELENOMETHIONINE

(no "Site" information available for 2Q05)

(no "SS Bond" information available for 2Q05)

(no "Cis Peptide Bond" information available for 2Q05)

(no "SAP(SNP)/Variant" information available for 2Q05)

Asymmetric Unit (3, 12)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_DUAL	PS50054	Dual specificity protein phosphatase family profile.	DUSP_VACCW	26-164	4	A:26-164 B:26-164 C:26-164 D:26-164
2	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	DUSP_VACCW	86-160	4	A:86-160 B:86-160 C:86-160 D:86-160
3	TYR_PHOSPHATASE_1	PS00383	Tyrosine specific protein phosphatases active site.	DUSP_VACCW	108-118	4	A:108-118 B:108-118 C:108-118 D:108-118

Biological Unit 1 (3, 36)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_DUAL	PS50054	Dual specificity protein phosphatase family profile.	DUSP_VACCW	26-164	12	A:26-164 B:26-164 C:26-164 D:26-164
2	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	DUSP_VACCW	86-160	12	A:86-160 B:86-160 C:86-160 D:86-160
3	TYR_PHOSPHATASE_1	PS00383	Tyrosine specific protein phosphatases active site.	DUSP_VACCW	108-118	12	A:108-118 B:108-118 C:108-118 D:108-118

(no "Exon" information available for 2Q05)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:181
 aligned with DUSP_VACCW | P07239 from UniProtKB/Swiss-Prot  Length:171

    Alignment length:181
                                        1                                                                                                                                                                        
                                     -  |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168 
           DUSP_VACCW     - ------------MDKKSLYKYLLLRSTGDMHKAKSPTIMTRVTNNVYLGNYKNAMDAPSSEVKFKYVLNLTMDKYTLPNSNINIIHIPLVDDTTTDISKYFDDVTAFLSKCDQRNEPVLVHCAAGVNRSGAMILAYLMSKNKESLPMLYFLYVYHSMRDLRGAFVENPSFKRQIIEKYVID 169
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............hhhhhhhhhhhhhh............ee....eeeehhhhhhhh........eeee.............eeee..........hhhhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -------------------------------------TYR_PHOSPHATASE_DUAL  PDB: A:26-164 UniProt: 26-164                                                                                        ----- PROSITE (1)
                PROSITE (2) -------------------------------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: A:86-160 UniProt: 86-160                           --------- PROSITE (2)
                PROSITE (3) -----------------------------------------------------------------------------------------------------------------------TYR_PHOSPHA--------------------------------------------------- PROSITE (3)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2q05 A -15 HHHHSSGYFQGHmDKKSLYKYLLLRSTGDmHRAKSPTImTRVTNNVYLGNYKNAmDAPSSEVKFKYVLNLTmDKYTLPNSNINIIHIPLVDDTTTDISKYFDDVTAFLSKCDQRNEPVLVHCAAGVNRSGAmILAYLmSKNKESLPmLYFLYVYHSmRDLRGAFVENPSFKRQIIEKYVID 169
                                  ||-2  |      8        18        28        38    |   48        58 |      68        78        88        98       108       118 |     128      |138      |148       158       168 
                                 -9|    |               18-MSE   27-MSE          43-MSE           60-MSE                                                     120-MSE |      135-MSE   145-MSE                    
                                  -4    |                                                                                                                          126-MSE                                       
                                        1-MSE

Chain B from PDB  Type:PROTEIN  Length:179
 aligned with DUSP_VACCW | P07239 from UniProtKB/Swiss-Prot  Length:171

    Alignment length:179
                                    1                                                                                                                                                                          
                                    |2        12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162         
           DUSP_VACCW     - --------MDKKSLYKYLLLRSTGDMHKAKSPTIMTRVTNNVYLGNYKNAMDAPSSEVKFKYVLNLTMDKYTLPNSNINIIHIPLVDDTTTDISKYFDDVTAFLSKCDQRNEPVLVHCAAGVNRSGAMILAYLMSKNKESLPMLYFLYVYHSMRDLRGAFVENPSFKRQIIEKYVIDKN 171
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh...hhhhhhhhhhhhhh............ee....eeeehhhhhhhh........eeee.............eeee..........hhhhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---------------------------------TYR_PHOSPHATASE_DUAL  PDB: B:26-164 UniProt: 26-164                                                                                        ------- PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: B:86-160 UniProt: 86-160                           ----------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------------------------------TYR_PHOSPHA----------------------------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2q05 B  -7 ENLYFQGHmDKKSLYKYLLLRSTGDmHRAKSPTImTRVTNNVYLGNYKNAmDAPSSEVKFKYVLNLTmDKYTLPNSNINIIHIPLVDDTTTDISKYFDDVTAFLSKCDQRNEPVLVHCAAGVNRSGAmILAYLmSKNKESLPmLYFLYVYHSmRDLRGAFVENPSFKRQIIEKYVIDKN 171
                                    |2        12     |  22    |   32        42|       52       |62        72        82        92       102       112       122   |   132  |    142  |    152       162         
                                    1-MSE           18-MSE   27-MSE          43-MSE           60-MSE                                                     120-MSE |      135-MSE   145-MSE                      
                                                                                                                                                               126-MSE

Chain C from PDB  Type:PROTEIN  Length:172
 aligned with DUSP_VACCW | P07239 from UniProtKB/Swiss-Prot  Length:171

    Alignment length:172
                              1                                                                                                                                                                         
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168  
           DUSP_VACCW     - --MDKKSLYKYLLLRSTGDMHKAKSPTIMTRVTNNVYLGNYKNAMDAPSSEVKFKYVLNLTMDKYTLPNSNINIIHIPLVDDTTTDISKYFDDVTAFLSKCDQRNEPVLVHCAAGVNRSGAMILAYLMSKNKESLPMLYFLYVYHSMRDLRGAFVENPSFKRQIIEKYVIDK 170
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhh............ee....eeeehhhhhhhhhhh.....eeee.............eeee..........hhhhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---------------------------TYR_PHOSPHATASE_DUAL  PDB: C:26-164 UniProt: 26-164                                                                                        ------ PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: C:86-160 UniProt: 86-160                           ---------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------------------------TYR_PHOSPHA---------------------------------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2q05 C  -1 GHmDKKSLYKYLLLRSTGDmHRAKSPTImTRVTNNVYLGNYKNAmDAPSSEVKFKYVLNLTmDKYTLPNSNINIIHIPLVDDTTTDISKYFDDVTAFLSKCDQRNEPVLVHCAAGVNRSGAmILAYLmSKNKESLPmLYFLYVYHSmRDLRGAFVENPSFKRQIIEKYVIDK 170
                              |      8        18        28        38    |   48        58 |      68        78        88        98       108       118 |     128      |138      |148       158       168  
                              1-MSE           18-MSE   27-MSE          43-MSE           60-MSE                                                     120-MSE |      135-MSE   145-MSE                     
                                                                                                                                                         126-MSE

Chain D from PDB  Type:PROTEIN  Length:181
 aligned with DUSP_VACCW | P07239 from UniProtKB/Swiss-Prot  Length:171

    Alignment length:181
                                       1                                                                                                                                                                         
                                     - |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169 
           DUSP_VACCW     - -----------MDKKSLYKYLLLRSTGDMHKAKSPTIMTRVTNNVYLGNYKNAMDAPSSEVKFKYVLNLTMDKYTLPNSNINIIHIPLVDDTTTDISKYFDDVTAFLSKCDQRNEPVLVHCAAGVNRSGAMILAYLMSKNKESLPMLYFLYVYHSMRDLRGAFVENPSFKRQIIEKYVIDK 170
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) --------------------------------------------DSPc-2q05D01 D:34-168                                                                                                                  -- Pfam domains (1)
           Pfam domains (2) --------------------------------------------DSPc-2q05D02 D:34-168                                                                                                                  -- Pfam domains (2)
           Pfam domains (3) --------------------------------------------DSPc-2q05D03 D:34-168                                                                                                                  -- Pfam domains (3)
           Pfam domains (4) --------------------------------------------DSPc-2q05D04 D:34-168                                                                                                                  -- Pfam domains (4)
         Sec.struct. author ............hhhhhhhhhhhhh.............ee....eeeehhhhhhhhhhh.....eeee.............eeee..........hhhhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------------------------------TYR_PHOSPHATASE_DUAL  PDB: D:26-164 UniProt: 26-164                                                                                        ------ PROSITE (1)
                PROSITE (2) ------------------------------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: D:86-160 UniProt: 86-160                           ---------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------------------------------------------TYR_PHOSPHA---------------------------------------------------- PROSITE (3)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2q05 D -13 HHSSGREFQGHmDKKSLYKYLLLRSTGDmHRAKSPTImTRVTNNVYLGNYKNAmDAPSSEVKFKYVLNLTmDKYTLPNSNINIIHIPLVDDTTTDISKYFDDVTAFLSKCDQRNEPVLVHCAAGVNRSGAmILAYLmSKNKESLPmLYFLYVYHSmRDLRGAFVENPSFKRQIIEKYVIDK 170
                                  ||-1 |       9        19       |29        39   |    49        59|       69        79        89        99       109       119|     |129     | 139     | 149       159       169 
                                 -7|   |               18-MSE   27-MSE          43-MSE           60-MSE                                                     120-MSE |      135-MSE   145-MSE                     
                                  -3   |                                                                                                                          126-MSE                                        
                                       1-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2Q05)

(no "CATH Domain" information available for 2Q05)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Phosphatase (121)

Family: DSPc (22)

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) (1)

1a	DSPc-2q05D01	D:34-168
1b	DSPc-2q05D02	D:34-168
1c	DSPc-2q05D03	D:34-168
1d	DSPc-2q05D04	D:34-168

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (DUSP_VACCW | P07239)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0016791	phosphatase activity	Catalysis of the hydrolysis of phosphoric monoesters, releasing inorganic phosphate.
	GO:0004721	phosphoprotein phosphatase activity	Catalysis of the reaction: a phosphoprotein + H2O = a protein + phosphate. Together with protein kinases, these enzymes control the state of phosphorylation of cell proteins and thereby provide an important mechanism for regulating cellular activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004725	protein tyrosine phosphatase activity	Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
	GO:0008138	protein tyrosine/serine/threonine phosphatase activity	Catalysis of the reactions: protein serine + H2O = protein serine + phosphate; protein threonine phosphate + H2O = protein threonine + phosphate; and protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
biological process
	GO:0016311	dephosphorylation	The process of removing one or more phosphoric (ester or anhydride) residues from a molecule.
	GO:0030683	evasion or tolerance by virus of host immune response	Any process, either active or passive, by which a virus avoids the effects of the host organism's immune response. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0035335	peptidyl-tyrosine dephosphorylation	The removal of phosphoric residues from peptidyl-O-phospho-tyrosine to form peptidyl-tyrosine.
	GO:0006470	protein dephosphorylation	The process of removing one or more phosphoric residues from a protein.
	GO:0039563	suppression by virus of host STAT1 activity	Any process in which a virus stops, prevents, or reduces the frequency, rate or extent of host STAT1 (signal transducer and activator of transcription-1) activity. STATs are SH2 domain-containing proteins which lie downstream of many signaling receptors. Upon phosphorylation by JAKs, STAT proteins hetero- or homo-dimerize and translocate to the nucleus to activate transcription of target genes.
	GO:0039503	suppression by virus of host innate immune response	Any process in which a virus stops, prevents, or reduces the frequency, rate or extent of the innate immune response of the host organism, the host's first line of defense.
	GO:0039502	suppression by virus of host type I interferon-mediated signaling pathway	Any process in which a virus stops, prevents, or reduces the frequency, rate or extent of type I interferon-mediated signaling in the host organism. Type I interferons include the interferon-alpha, beta, delta, episilon, zeta, kappa, tau, and omega gene families.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0030430	host cell cytoplasm	The cytoplasm of a host cell.
	GO:0019012	virion	The complete fully infectious extracellular virus particle.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 2q05)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2q05)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2q05
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	DUSP_VACCW \| P07239
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.3.16
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc
	3.1.3.48
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	DUSP_VACCW \| P07239
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	DUSP_VACCW \| P07239	:	2rf6 3cm3

(no "Related Entries Specified in the PDB File" available for 2Q05)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 36)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 12)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (1, 4)

Gene Ontology (16, 16)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File