Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  PANDINUS TOXIN K-A (PITX-KA) FROM PANDINUS IMPERATOR, NMR, 20 STRUCTURES
 
Authors :  T. C. Tenenholz, R. S. Rogowski, J. H. Collins, M. P. Blaustein, D. J. Weber
Date :  26 Nov 96  (Deposition) - 10 Dec 97  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Neurotoxin, Potassium Channel Blockers, Nmr Solution Structure, Alpha-K Toxin Family, Scorpion Toxin (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. C. Tenenholz, R. S. Rogowski, J. H. Collins, M. P. Blaustein, D. J. Weber
Solution Structure For Pandinus Toxin K-Alpha (Pitx-K Alpha), A Selective Blocker Of A-Type Potassium Channels.
Biochemistry V. 36 2763 1997
PubMed-ID: 9062103  |  Reference-DOI: 10.1021/BI9628432
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PANDINUS TOXIN K-ALPHA
    Cell Line: BL21
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PSR9
    Expression System Strain: BL21 (DE3)
    Expression System Taxid: 469008
    Fragment: COMPLETE PEPTIDE
    Organism Common: EMPEROR SCORPION
    Organism Scientific: PANDINUS IMPERATOR
    Organism Taxid: 55084
    Synonym: PITX-KA, A-KTX5.1

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2PTA)

(-) Sites  (0, 0)

(no "Site" information available for 2PTA)

(-) SS Bonds  (3, 3)

NMR Structure
No.Residues
1A:7 -A:28
2A:13 -A:33
3A:17 -A:35

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2PTA)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2PTA)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SCORP_SHORT_TOXINPS01138 Scorpion short toxins signature.KAX71_PANIM22-44  1A:13-35

(-) Exons   (0, 0)

(no "Exon" information available for 2PTA)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:35
 aligned with KAX71_PANIM | P55927 from UniProtKB/Swiss-Prot  Length:47

    Alignment length:35
                                    22        32        42     
           KAX71_PANIM   13 TISCTNPKQCYPHCKKETGYPNAKCMNRKCKCFGR 47
               SCOP domains d2ptaa_ A: Pandinus toxin           SCOP domains
               CATH domains ----------------------------------- CATH domains
               Pfam domains -Toxin_2-2ptaA01 A:5-36          -- Pfam domains
         Sec.struct. author .......hhhhhhhhhhh....eee....eee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------- SAPs(SNPs)
                    PROSITE ---------SCORP_SHORT_TOXIN      --- PROSITE
                 Transcript ----------------------------------- Transcript
                  2pta A  4 TISCTNPKQCYPHCKKETGYPNAKCMNRKCKCFGR 38
                                    13        23        33
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Small proteins (3458)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2PTA)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: Knottin_1 (78)

(-) Gene Ontology  (4, 4)

NMR Structure(hide GO term definitions)
Chain A   (KAX71_PANIM | P55927)
molecular function
    GO:0008200    ion channel inhibitor activity    Stops, prevents, or reduces the activity of an ion channel.
biological process
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2pta)
 
  Sites
(no "Sites" information available for 2pta)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2pta)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2pta
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KAX71_PANIM | P55927
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  KAX71_PANIM | P55927
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2PTA)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2PTA)