|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2PRD) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2PRD) |
PROSITE Motifs (1, 1)
Asymmetric Unit (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2PRD) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:174 aligned with IPYR_THET8 | P38576 from UniProtKB/Swiss-Prot Length:175 Alignment length:174 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 IPYR_THET8 2 ANLKSLPVGDKAPEVVHMVIEVPRGSGNKYEYDPDLGAIKLDRVLPGAQFYPGDYGFIPSTLAEDGDPLDGLVLSTYPLLPGVVVEVRVVGLLLMEDEKGGDAKVIGVVAEDQRLDHIQDIGDVPEGVKQEIQHFFETYKALEAKKGKWVKVTGWRDRKAALEEVRACIARYKG 175 SCOP domains d2prda_ A: Inorganic pyrophosphatase SCOP domains CATH domains 2prdA00 A:1-174 Inorganic Pyrophosphatase CATH domains Pfam domains ----------------Pyrophosphatase-2prdA01 A:17-174 Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ----------------------------------------------------------------PPASE ------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 2prd A 1 ANLKSLPVGDKAPEVVHMVIEVPRGSGNKYEYDPDLGAIKLDRVLPGAQFYPGDYGFIPSTLAEDGDPLDGLVLSTYPLLPGVVVEVRVVGLLLMEDEKGGDAKVIGVVAEDQRLDHIQDIGDVPEGVKQEIQHFFETYKALEAKKGKWVKVTGWRDRKAALEEVRACIARYKG 174 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (6, 6)|
Asymmetric Unit(hide GO term definitions) Chain A (IPYR_THET8 | P38576)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|