|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 7)| Asymmetric Unit (3, 7) Biological Unit 1 (2, 10) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2PN2) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2PN2) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2PN2) |
Exons (0, 0)| (no "Exon" information available for 2PN2) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:137 aligned with Q4FU81_PSYA2 | Q4FU81 from UniProtKB/TrEMBL Length:136 Alignment length:137 1 | 5 15 25 35 45 55 65 75 85 95 105 115 125 Q4FU81_PSYA2 - -----MTTSKVTYQGDLRTSAIHLQSNNEIITDAPVDNQGKGEAFSPTDLLATSLASCMLTIIGIKARDMEIDIAGTTAEVTKVMAADPRRVSEVHIAITFNQELDDKTQKIFYNTALTCPVAKSIHPDIFQKVIIH 132 SCOP domains -----d2pn2a1 A:1-132 Uncharacterized protein Psyc0566 SCOP domains CATH domains 2pn2A00 A:-4-132 [code=3.30.300.20, no name defined] CATH domains Pfam domains ---------------------------------------OsmC-2pn2A01 A:35-129 --- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript 2pn2 A -4 LYFQGmTTSKVTYQGDLRTSAIHLQSNNEIITDAPVDNQGKGEAFSPTDLLATSLASCmLTIIGIKARDmEIDIAGTTAEVTKVmAADPRRVSEVHIAITFNQELDDKTQKIFYNTALTCPVAKSIHPDIFQKVIIH 132 | 5 15 25 35 45 55 65 75 | 85 95 105 115 125 1-MSE 54-MSE 65-MSE 80-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2PN2)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|