Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF CRYPTOSPORIDIUM PARVUM CYCLOPHILIN TYPE PEPTIDYL-PROLYL CIS-TRANS ISOMERASE CGD2_4120
 
Authors :  A. K. Wernimont, J. Lew, T. Hills, I. Kozieradzki, Y. H. Lin, A. Hassanali, Y. Zhao, M. Schapira, C. H. Arrowsmith, A. M. Edwards, J. Weigelt, M. Sundstrom, A. Bochkarev, R. Hui, J. D. Artz, T. Xiao, Structural Genomics Consortium (Sgc)
Date :  20 Apr 07  (Deposition) - 22 May 07  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.82
Chains :  Asym./Biol. Unit :  A
Keywords :  Cyclophilin, Malaria, Cryptosporidium, Structural Genomics, Structural Genomics Consortium, Sgc, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. K. Wernimont, J. Lew, T. Hills, I. Kozieradzki, Y. H. Lin, A. Hassanali, Y. Zhao, M. Schapira, C. H. Arrowsmith, A. M. Edwards, J. Weigelt, M. Sundstrom, A. Bochkarev, R. Hui, J. D. Artz, T. Xiao
Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120.
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - 20K CYCLOPHILIN, PUTATIVE
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: P15_MHL
    Expression System Strain: DH5A
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: CGD2_4120
    Organism Scientific: CRYPTOSPORIDIUM PARVUM IOWA II
    Organism Taxid: 353152
    Strain: IOWA TYPE II

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2PLU)

(-) Sites  (0, 0)

(no "Site" information available for 2PLU)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2PLU)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2PLU)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2PLU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2PLU)

(-) Exons   (0, 0)

(no "Exon" information available for 2PLU)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:172
 aligned with A3FQA7_CRYPI | A3FQA7 from UniProtKB/TrEMBL  Length:172

    Alignment length:173
                               1                                                                                                                                                                         
                               |     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167   
         A3FQA7_CRYPI     - ---MPNPVVYFDISIGQTPAGRITMELFADKVPITAENFRALCTGEKGMGQSGKPLCYTGSFFHRIIPQFMIQGGDFTRGDGTGGESIYGSKFRDENFVYTHDAPFLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGKVLEGMEVVKSIEKCGSQNGKPTKSVCITASGV 170
               SCOP domains d2plua_ A: automated matches                                                                                                                                                  SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee..eeeeeeeeee..eeeeeeeeee....hhhhhhhhhhhhhh...................eee...eeee................-...............eeee...........eeee...hhhhh....eeeeeeehhhhhhhhhh...........eeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2plu A  14 LYFQGNPVVYFDISIGQTPAGRITMELFADKVPITAENFRALCTGEKGMGQSGKPLCYTGSFFHRIIPQFMIQGGDFTRGDGTGGESIYG-KFRDENFVYTHDAPFLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGKVLEGMEVVKSIEKCGSQNGKPTKSVCITASGV 186
                                    23        33        43        53        63        73        83        93       103 |     113       123       133       143       153       163       173       183   
                                                                                                                   103 |                                                                                 
                                                                                                                     105
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2PLU)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2PLU)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (A3FQA7_CRYPI | A3FQA7)
molecular function
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
    GO:0003755    peptidyl-prolyl cis-trans isomerase activity    Catalysis of the reaction: peptidyl-proline (omega=180) = peptidyl-proline (omega=0).
biological process
    GO:0006457    protein folding    The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
    GO:0000413    protein peptidyl-prolyl isomerization    The modification of a protein by cis-trans isomerization of a proline residue.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2plu)
 
  Sites
(no "Sites" information available for 2plu)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2plu)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2plu
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A3FQA7_CRYPI | A3FQA7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A3FQA7_CRYPI | A3FQA7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        A3FQA7_CRYPI | A3FQA7: 2poy

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2PLU)