Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF A PROTEIN OF UNKNOWN FUNCTION FROM CORYNEBACTERIUM GLUTAMICUM ATCC 13032
 
Authors :  R. Zhang, E. Duggan, M. Gu, A. Joachimiak, Midwest Center For Struct Genomics (Mcsg)
Date :  23 Mar 07  (Deposition) - 08 May 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.35
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Corynebacterium Glutamicum, Structural Genomics, Psi-2, Mcsg, Protein Structure Initiative, Midwest Center For Structural Genomics, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Zhang, E. Duggan, M. Gu, A. Joachimiak
The Crystal Structure Of A Protein Of Unknown Function From Corynebacterium Glutamicum Atcc 13032
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN CGL1923
    Chains: A, B, C
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21
    Expression System Plasmid: PDM68
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Expression System Vector Type: PLASMID
    Gene: CGL1923, CG2106
    Organism Scientific: CORYNEBACTERIUM GLUTAMICUM ATCC 13032
    Organism Taxid: 196627
    Strain: DSM 20300, JCM 1318, LMG 3730, NCIMB 10025

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit : ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2P90)

(-) Sites  (0, 0)

(no "Site" information available for 2P90)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2P90)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Tyr A:13 -Pro A:14
2Ser A:168 -Leu A:169
3Tyr B:13 -Pro B:14
4Ser B:19 -Gly B:20
5Gln B:21 -Thr B:22
6Tyr C:13 -Pro C:14

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2P90)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2P90)

(-) Exons   (0, 0)

(no "Exon" information available for 2P90)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:269
 aligned with Q8NP93_CORGL | Q8NP93 from UniProtKB/TrEMBL  Length:319

    Alignment length:269
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265         
         Q8NP93_CORGL     6 DRMYELEYPSPEVSGQTAGGPTLIVALQGYADAGHAVESSSSHLMDALDHRLIASFNNDELIDYRSRRPVVVIEHNEVTSMDELNLGLHVVRDNDNKPFLMLSGPEPDLRWGDFSNAVVDLVEKFGVENTICLYAAPMTVPHTRPTVVTAHGNSTDRLKDQVSLDTRMTVPGSASLMLEKLLKDKGKNVSGYTVHVPHYVSASPYPAATLKLLQSIADSADLNLPLLALERDAEKVHRQLMEQTEESSEIQRVVGALEQQYDSELERYR 274
               SCOP domains d2p90a1 A:6-274 Hypothetical protein Cgl1923                                                                                                                                                                                                                                  SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2p90A02 A:230-274                             CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eee...............eeeeeee...hhhhhhhhhhhhhhhhh.eeeeeeehhhhhhhhhhhh..eee....eeee.....eeeeee.....eeeeeeee....hhhhhhhhhhhhhhhh...eeeeeeeeee.........eeeee.hhhhh.........eee..hhhhhhhhhhhhh...eeeeeeeee.hhh...hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2p90 A   6 DRMYELEYPSPEVSGQTAGGPTLIVALQGYADAGHAVESSSSHLMDALDHRLIASFNNDELIDYRSRRPVVVIEHNEVTSMDELNLGLHVVRDNDNKPFLMLSGPEPDLRWGDFSNAVVDLVEKFGVENTICLYAAPMTVPHTRPTVVTAHGNSTDRLKDQVSLDTRMTVPGSASLMLEKLLKDKGKNVSGYTVHVPHYVSASPYPAATLKLLQSIADSADLNLPLLALERDAEKVHRQLMEQTEESSEIQRVVGALEQQYDSELERYR 274
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265         


Chain B from PDB  Type:PROTEIN  Length:271
 aligned with Q8NP93_CORGL | Q8NP93 from UniProtKB/TrEMBL  Length:319

    Alignment length:271
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277 
         Q8NP93_CORGL     8 MYELEYPSPEVSGQTAGGPTLIVALQGYADAGHAVESSSSHLMDALDHRLIASFNNDELIDYRSRRPVVVIEHNEVTSMDELNLGLHVVRDNDNKPFLMLSGPEPDLRWGDFSNAVVDLVEKFGVENTICLYAAPMTVPHTRPTVVTAHGNSTDRLKDQVSLDTRMTVPGSASLMLEKLLKDKGKNVSGYTVHVPHYVSASPYPAATLKLLQSIADSADLNLPLLALERDAEKVHRQLMEQTEESSEIQRVVGALEQQYDSELERYRNRHP 278
               SCOP domains d2p90b_ B: Hypothetical protein Cgl1923                                                                                                                                                                                                                                         SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2p90B02 B:230-278                                 CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee...............eeeeeee...hhhhhhhhhhhhhhhhheeeeeeeehhhhhhhhhhhh..eee....eeee.....eeeeee.....eeeeeeee....hhhhhhhhhhhhhhhh...eeeeeeeeee.........eeeee.hhhhh.........eee..hhhhhhhhhhhhh...eeeeeeeee.hhh...hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2p90 B   8 MYELEYPSPEVSGQTAGGPTLIVALQGYADAGHAVESSSSHLMDALDHRLIASFNNDELIDYRSRRPVVVIEHNEVTSMDELNLGLHVVRDNDNKPFLMLSGPEPDLRWGDFSNAVVDLVEKFGVENTICLYAAPMTVPHTRPTVVTAHGNSTDRLKDQVSLDTRMTVPGSASLMLEKLLKDKGKNVSGYTVHVPHYVSASPYPAATLKLLQSIADSADLNLPLLALERDAEKVHRQLMEQTEESSEIQRVVGALEQQYDSELERYRNRHP 278
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277 


Chain C from PDB  Type:PROTEIN  Length:266
 aligned with Q8NP93_CORGL | Q8NP93 from UniProtKB/TrEMBL  Length:319

    Alignment length:268
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266        
         Q8NP93_CORGL     7 RMYELEYPSPEVSGQTAGGPTLIVALQGYADAGHAVESSSSHLMDALDHRLIASFNNDELIDYRSRRPVVVIEHNEVTSMDELNLGLHVVRDNDNKPFLMLSGPEPDLRWGDFSNAVVDLVEKFGVENTICLYAAPMTVPHTRPTVVTAHGNSTDRLKDQVSLDTRMTVPGSASLMLEKLLKDKGKNVSGYTVHVPHYVSASPYPAATLKLLQSIADSADLNLPLLALERDAEKVHRQLMEQTEESSEIQRVVGALEQQYDSELERYR 274
               SCOP domains d2p90c_ C: Hypothetical protein Cgl1923                                                                                                                                                                                                                                      SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2p90C02 C:230-274                             CATH domains
           Pfam domains (1) ------------------------PAC2-2p90C01 C:31-264                                                                                                                                                                                                                     ---------- Pfam domains (1)
           Pfam domains (2) ------------------------PAC2-2p90C02 C:31-264                                                                                                                                                                                                                     ---------- Pfam domains (2)
           Pfam domains (3) ------------------------PAC2-2p90C03 C:31-264                                                                                                                                                                                                                     ---------- Pfam domains (3)
         Sec.struct. author ..eee...............eeeeeee...hhhhhhhhhhhhhhhhh.eeeeeeehhhhhhhhhhhh..eeee..eeeee.....eeeeee.....eeeeeeee....hhhhhhhhhhhhhhhh...eeeeeeeeee........eeeeee.hhhhh.....--..eee..hhhhhhhhhhhhh...eeeeeeeee.hhh...hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2p90 C   7 RMYELEYPSPEVSGQTAGGPTLIVALQGYADAGHAVESSSSHLMDALDHRLIASFNNDELIDYRSRRPVVVIEHNEVTSMDELNLGLHVVRDNDNKPFLMLSGPEPDLRWGDFSNAVVDLVEKFGVENTICLYAAPMTVPHTRPTVVTAHGNSTDRLKDQVS--TRMTVPGSASLMLEKLLKDKGKNVSGYTVHVPHYVSASPYPAATLKLLQSIADSADLNLPLLALERDAEKVHRQLMEQTEESSEIQRVVGALEQQYDSELERYR 274
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166 |  |  176       186       196       206       216       226       236       246       256       266        
                                                                                                                                                                                           168  |                                                                                                       
                                                                                                                                                                                              171
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 3)

Asymmetric/Biological Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 3)

Asymmetric/Biological Unit
(-)
Clan: no clan defined [family: PAC2] (2)

(-) Gene Ontology  (1, 1)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C   (Q8NP93_CORGL | Q8NP93)
biological process
    GO:0006367    transcription initiation from RNA polymerase II promoter    Any process involved in the assembly of the RNA polymerase II preinitiation complex (PIC) at an RNA polymerase II promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. Promoter clearance, or release, is the transition between the initiation and elongation phases of transcription.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2p90)
 
  Sites
(no "Sites" information available for 2p90)
 
  Cis Peptide Bonds
    Gln B:21 - Thr B:22   [ RasMol ]  
    Ser A:168 - Leu A:169   [ RasMol ]  
    Ser B:19 - Gly B:20   [ RasMol ]  
    Tyr A:13 - Pro A:14   [ RasMol ]  
    Tyr B:13 - Pro B:14   [ RasMol ]  
    Tyr C:13 - Pro C:14   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2p90
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8NP93_CORGL | Q8NP93
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8NP93_CORGL | Q8NP93
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2P90)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2P90)