|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (5, 26) |
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 2P4P) |
(no "Cis Peptide Bond" information available for 2P4P) |
(no "SAP(SNP)/Variant" information available for 2P4P) |
(no "PROSITE Motif" information available for 2P4P) |
(no "Exon" information available for 2P4P) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:84 aligned with Q7VKS4_HAEDU | Q7VKS4 from UniProtKB/TrEMBL Length:429 Alignment length:84 354 364 374 384 394 404 414 424 Q7VKS4_HAEDU 345 QIMRRNEDSWLIDGATPLEDVMRALNIHTFPRDENYETIGGFMMYMLRKIPKKTDFVLYDKYKFEIIDTENFRIDQLMVSFRKD 428 SCOP domains --d2p4pa1 A:1-82 Hypothetical protein HD1797 SCOP domains CATH domains 2p4pA00 A:-1-82 [code=3.30.465.10, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------ Transcript 2p4p A -1 NAmRRNEDSWLIDGATPLEDVmRALNIHTFPRDENYETIGGFmmYmLRkIPkkTDFVLYDkYkFEIIDTENFRIDQLmVSFRkD 82 | 8 18 | 28 38 || | 48 || 58| | 68 |78 | | 20-MSE 41-MSE | || 59-MLY 76-MSE| 1-MSE 42-MSE| || 61-MLY 81-MLY 44-MSE || 47-MLY 50-MLY 51-MLY Chain B from PDB Type:PROTEIN Length:77 aligned with Q7VKS4_HAEDU | Q7VKS4 from UniProtKB/TrEMBL Length:429 Alignment length:77 361 371 381 391 401 411 421 Q7VKS4_HAEDU 352 DSWLIDGATPLEDVMRALNIHTFPRDENYETIGGFMMYMLRKIPKKTDFVLYDKYKFEIIDTENFRIDQLMVSFRKD 428 SCOP domains d2p4pb_ B: Hypothetical protein HD1797 SCOP domains CATH domains 2p4pB00 B:6-82 [code=3.30.465.10, no name defined] CATH domains Pfam domains (1) CorC_HlyC-2p4pB01 B:6-81 - Pfam domains (1) Pfam domains (2) CorC_HlyC-2p4pB02 B:6-81 - Pfam domains (2) SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------- Transcript 2p4p B 6 DSWLIDGATPLEDVmRALNIHTFPRDENYETIGGFmmYmLRkIPkkTDFVLYDkYkFEIIDTENFRIDQLmVSFRkD 82 15 | 25 35 || 45 | || 55 | | 65 75| | 20-MSE 41-MSE | || 59-MLY 76-MSE| 42-MSE| || 61-MLY 81-MLY 44-MSE || 47-MLY 50-MLY 51-MLY
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (Q7VKS4_HAEDU | Q7VKS4)
|
|
|
|
|
|
|