Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE UPF0352 PROTEIN CPS_2611 FROM COLWELLIA PSYCHRERYTHRAEA. NESG TARGET CSR4.
 
Authors :  S. M. Vorobiev, W. Zhou, M. Su, J. Seetharaman, H. Wang, H. Janjua, K. Cun L-C. Ma, R. Xiao, C. Liu, T. B. Acton, G. T. Montelione, L. Tong, J. F. Hun Northeast Structural Genomics Consortium (Nesg)
Date :  07 Feb 07  (Deposition) - 20 Feb 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Nesg, Y2611_colp3, Upf0352, Cps_2611, Structural Genomics, Psi-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. M. Vorobiev, W. Zhou, M. Su, J. Seetharaman, H. Wang, H. Janjua, K. Cunningham, L-C. Ma, C. Liu, T. B. Acton, R. Xiao, G. T. Montelione, L. Tong, J. F. Hunt
Crystal Structure Of The Upf0352 Protein Cps_2611 From Colwellia Psychrerythraea. Nesg Target Csr4.
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - UPF0352 PROTEIN CPS_2611
    Atcc: BAA-681
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET21
    Expression System Strain: BL21(DE3)+MAGIC
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: CPS_2611
    Organism Scientific: COLWELLIA PSYCHRERYTHRAEA
    Organism Taxid: 167879
    Strain: 34H

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1MSE2Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 2OTA)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2OTA)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2OTA)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2OTA)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2OTA)

(-) Exons   (0, 0)

(no "Exon" information available for 2OTA)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:67
 aligned with Y2611_COLP3 | Q481E4 from UniProtKB/Swiss-Prot  Length:68

    Alignment length:67
                                                                                        68     
                                    16        26        36        46        56        66 |     
           Y2611_COLP3    7 YSNERVEKIIQDLLDVLVKEEVTPDLALMCLGNAVTNIIAQVPESKRVAVVDNFTKALKQSV-----  -
               SCOP domains d2otaa1 A:7-68 Hypothetical protein CPS2611                   ----- SCOP domains
               CATH domains 2otaA00 A:7-73 YejL-like                                            CATH domains
               Pfam domains ------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------- Transcript
                  2ota A  7 YSNERVEKIIQDLLDVLVKEEVTPDLALmCLGNAVTNIIAQVPESKRVAVVDNFTKALKQSVLEHHH 73
                                    16        26        36        46        56        66       
                                                       35-MSE                                  


Chain B from PDB  Type:PROTEIN  Length:61
 aligned with Y2611_COLP3 | Q481E4 from UniProtKB/Swiss-Prot  Length:68

    Alignment length:61
                                                                                      68 
                                    18        28        38        48        58        68 
           Y2611_COLP3    9 NERVEKIIQDLLDVLVKEEVTPDLALMCLGNAVTNIIAQVPESKRVAVVDNFTKALKQSV-  -
               SCOP domains d2otab_ B: Hypothetical protein CPS2611                       SCOP domains
               CATH domains 2otaB00 B:9-69 YejL-like                                      CATH domains
           Pfam domains (1) -----------------DUF1414-2otaB01 B:26-68                    - Pfam domains (1)
           Pfam domains (2) -----------------DUF1414-2otaB02 B:26-68                    - Pfam domains (2)
         Sec.struct. author .hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------- Transcript
                  2ota B  9 NERVEKIIQDLLDVLVKEEVTPDLALmCLGNAVTNIIAQVPESKRVAVVDNFTKALKQSVL 69
                                    18        28      | 38        48        58        68 
                                                     35-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: no clan defined [family: DUF1414] (5)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Y2611_COLP3 | Q481E4)
molecular function
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
biological process
    GO:0008150    biological_process    Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.
cellular component
    GO:0005575    cellular_component    The part of a cell, extracellular environment or virus in which a gene product is located. A gene product may be located in one or more parts of a cell and its location may be as specific as a particular macromolecular complex, that is, a stable, persistent association of macromolecules that function together.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2ota)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ota)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ota
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Y2611_COLP3 | Q481E4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Y2611_COLP3 | Q481E4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        Y2611_COLP3 | Q481E4: 2jr2

(-) Related Entries Specified in the PDB File

csr4