Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR SOLUTION STRUCTURE OF A COMPLEX BETWEEN THE VIRB9/VIRB7 INTERACTION DOMAINS OF THE PKM101 TYPE IV SECRETION SYSTEM
 
Authors :  R. Harris, R. Bayliss, P. C. Driscoll, G. Waksman
Date :  04 Jan 07  (Deposition) - 23 Jan 07  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B  (20x)
Keywords :  Trao, Tran, Pkm101, Protein Transport/Protein Transport Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Bayliss, R. Harris, L. Coutte, A. Monier, R. Fronzes, P. J. Christie, P. C. Driscoll, G. Waksman
Nmr Structure Of A Complex Between The Virb9/Virb7 Interaction Domains Of The Pkm101 Type Iv Secretion System
Proc. Natl. Acad. Sci. Usa V. 104 1673 2007
PubMed-ID: 17244707  |  Reference-DOI: 10.1073/PNAS.0609535104
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TRAO
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Fragment: RESIDUES 177-271
    Gene: TRAO
    Organism Scientific: INCN PLASMID R46
    Organism Taxid: 179945
    Synonym: HYPOTHETICAL PROTEIN
 
Molecule 2 - TRAN
    Chains: B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Fragment: RESIDUES 21-42
    Gene: TRAN
    Organism Scientific: INCN PLASMID R46
    Organism Taxid: 179945

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2OFQ)

(-) Sites  (0, 0)

(no "Site" information available for 2OFQ)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2OFQ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2OFQ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2OFQ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2OFQ)

(-) Exons   (0, 0)

(no "Exon" information available for 2OFQ)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:95
 aligned with Q79SE3_SALTM | Q79SE3 from UniProtKB/TrEMBL  Length:294

    Alignment length:95
                                   186       196       206       216       226       236       246       256       266     
         Q79SE3_SALTM   177 AGAKNYQYVMSEQPEMRSIQPVHVWDNYRFTRFEFPANAELPQVYMISASGKETLPNSHVVGENRNIIEVETVAKEWRIRLGDKVVGVRNNNFAP 271
               SCOP domains ----------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eee.....hhhhh..eeee....eeee........eeeee.....ee...eeee.....eeee.....eeeeee..eeeeeee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------- Transcript
                 2ofq A 177 AGAKNYQYVMSEQPEMRSIQPVHVWDNYRFTRFEFPANAELPQVYMISASGKETLPNSHVVGENRNIIEVETVAKEWRIRLGDKVVGVRNNNFAP 271
                                   186       196       206       216       226       236       246       256       266     


Chain B from PDB  Type:PROTEIN  Length:22
 aligned with Q79SE5_SALTM | Q79SE5 from UniProtKB/TrEMBL  Length:48

    Alignment length:22
                                    30        40  
         Q79SE5_SALTM    21 PPPEPDWSNTVPVNKTIPVDTQ  42
               SCOP domains ---------------------- SCOP domains
               CATH domains ---------------------- CATH domains
               Pfam domains ---------------------- Pfam domains
         Sec.struct. author ..........ee.......... Sec.struct. author
                 SAPs(SNPs) ---------------------- SAPs(SNPs)
                    PROSITE ---------------------- PROSITE
                 Transcript ---------------------- Transcript
                 2ofq B  21 PPPEPDWSNTVPVNKTIPVDTQ  42
                                    30        40
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2OFQ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2OFQ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2OFQ)

(-) Gene Ontology  (0, 0)

NMR Structure(hide GO term definitions)
    (no "Gene Ontology" information available for 2OFQ)

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ofq)
 
  Sites
(no "Sites" information available for 2ofq)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ofq)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ofq
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q79SE3_SALTM | Q79SE3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
  Q79SE5_SALTM | Q79SE5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q79SE3_SALTM | Q79SE3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q79SE5_SALTM | Q79SE5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2OFQ)

(-) Related Entries Specified in the PDB File

6936