2OFH - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SOLUTION STRUCTURE OF THE N-TERMINAL DOMAIN OF THE ZINC(II) ATPASE ZIAA IN ITS APO FORM

Authors :   L. Banci, I. Bertini, S. Ciofi-Baffoni, L. Poggi, N. J. Robinson, M. Van

Date :   03 Jan 07 (Deposition) - 18 Dec 07 (Release) - 13 Jul 11 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : X
NMR Structure *: X  (1x)

Keywords :   Ferredoxin-Like Fold; Beta-Alpha-Beta-Beta-Alpha-Beta; Structural Genomics; Spine, Hydrolase, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   L. Banci, I. Bertini, S. Ciofi-Baffoni, L. Poggi, M. Vanarotti, S. Tottey, K. J. Waldron, N. J. Robinson
Nmr Structural Analysis Of The Soluble Domain Of Ziaa-Atpas And The Basis Of Selective Interactions With Copper Metallochaperone Atx1.
J. Biol. Inorg. Chem. V. 15 87 2010
PubMed-ID: 19609573 | Reference-DOI: 10.1007/S00775-009-0568-7

Molecule 1 - ZINC-TRANSPORTING ATPASE
	Chains	:	X
	EC Number	:	3.6.3.5
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21
	Expression System Plasmid	:	PET29A
	Expression System Strain	:	BL21
	Expression System Taxid	:	511693
	Expression System Vector Type	:	PLASMID
	Fragment	:	RESIDUES 1-76
	Gene	:	ZIAA
	Organism Scientific	:	SYNECHOCYSTIS SP.
	Organism Taxid	:	1148
	Strain	:	PCC 6803
	Synonym	:	ZN(2+)-TRANSLOCATING P-TYPE ATPASE

		1
NMR Structure	:	X
NMR Structure * (1x)	:	X

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2OFH)

(no "Site" information available for 2OFH)

(no "SS Bond" information available for 2OFH)

(no "Cis Peptide Bond" information available for 2OFH)

(no "SAP(SNP)/Variant" information available for 2OFH)

NMR Structure (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HMA_2	PS50846	Heavy-metal-associated domain profile.	ATZN_SYNY3	9-75	1	X:9-75
2	HMA_1	PS01047	Heavy-metal-associated domain.	ATZN_SYNY3	14-43	1	X:14-43

NMR Structure * (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HMA_2	PS50846	Heavy-metal-associated domain profile.	ATZN_SYNY3	9-75	1	X:9-75
2	HMA_1	PS01047	Heavy-metal-associated domain.	ATZN_SYNY3	14-43	1	X:14-43

(no "Exon" information available for 2OFH)

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain X from PDB  Type:PROTEIN  Length:71
 aligned with ATZN_SYNY3 | Q59998 from UniProtKB/Swiss-Prot  Length:721

    Alignment length:71
                                    15        25        35        45        55        65        75 
            ATZN_SYNY3    6 PLKTQQMQVGGMDCTSCKLKIEGSLERLKGVAEASVTVATGRLTVTYDPKQVSEITIQERIAALGYTLAEP 76
               SCOP domains d2ofhx_ X: automated matches                                            SCOP domains
               CATH domains 2ofhX00 X:6-76  [code=3.30.70.100, no name defined]                     CATH domains
               Pfam domains ----------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee.......hhhhhhhhhh....eeeeeeehhh.eeeeee.....hhhhhhhhhhh....ee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---HMA_2  PDB: X:9-75 UniProt: 9-75                                   - PROSITE (1)
                PROSITE (2) --------HMA_1  PDB: X:14-43           --------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------- Transcript
                  2ofh X  6 PLKTQQMQVGGMDCTSCKLKIEGSLERLKGVAEASVTVATGRLTVTYDPKQVSEITIQERIAALGYTLAEP 76
                                    15        25        35        45        55        65        75

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Ferredoxin-like (1795)

Superfamily: HMA, heavy metal-associated domain (79)

Family: automated matches (20)

Protein domain: automated matches (20)

Synechocystis sp. [TaxId: 1148] (3)

d2ofhx_

NMR Structure

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Alpha-Beta Plaits (1688)

Homologous Superfamily: [code=3.30.70.100, no name defined] (82)

Pcc 6803 (Synechocystis sp) (10)

2ofhX00

X:6-76

(no "Pfam Domain" information available for 2OFH)

NMR Structure(hide GO term definitions)

Chain X (ATZN_SYNY3 | Q59998)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0015086	cadmium ion transmembrane transporter activity	Enables the transfer of cadmium (Cd) ions from one side of a membrane to the other.
	GO:0019829	cation-transporting ATPase activity	Catalysis of the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: ATP + H2O + cation(out) = ADP + phosphate + cation(in).
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005385	zinc ion transmembrane transporter activity	Enables the transfer of zinc (Zn) ions from one side of a membrane to the other.
	GO:0016463	zinc-exporting ATPase activity	Catalysis of the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: ATP + H2O + Zn2+(in) -> ADP + phosphate + Zn2+(out).
biological process
	GO:0070574	cadmium ion transmembrane transport	A process in which a cadmium ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
	GO:0098655	cation transmembrane transport	A process in which a cation is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
	GO:0006812	cation transport	The directed movement of cations, atoms or small molecules with a net positive charge, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0030001	metal ion transport	The directed movement of metal ions, any metal ion with an electric charge, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0071577	zinc II ion transmembrane transport	A process in which a zinc II ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
	GO:0006829	zinc II ion transport	The directed movement of zinc (Zn II) ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0043231	intracellular membrane-bounded organelle	Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ofh)

	Sites
(no "Sites" information available for 2ofh)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ofh)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2ofh
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ATZN_SYNY3 \| Q59998
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.6.3.5
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ATZN_SYNY3 \| Q59998
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	ATZN_SYNY3 \| Q59998	:	2ldi 2ofg

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (21, 21)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File