|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (3, 6)
|
Asymmetric Unit (3, 3)
|
(no "SS Bond" information available for 2ODK) |
(no "Cis Peptide Bond" information available for 2ODK) |
(no "SAP(SNP)/Variant" information available for 2ODK) |
(no "PROSITE Motif" information available for 2ODK) |
(no "Exon" information available for 2ODK) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:51 aligned with Q82T22_NITEU | Q82T22 from UniProtKB/TrEMBL Length:85 Alignment length:51 10 20 30 40 50 Q82T22_NITEU 1 MHVWPVQDAKARFSEFLDACITEGPQIVSRRGAEEAVLVPIGEWRRLQAAA 51 SCOP domains d2odka1 A:1-51 Hypothetical protein NE2111 SCOP domains CATH domains -2odkA00 A:2-51 YefM-like domain CATH domains Pfam domains --------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------- PROSITE Transcript --------------------------------------------------- Transcript 2odk A 1 mHVWPVQDAKARFSEFLDACITEGPQIVSRRGAEEAVLVPIGEWRRLQAAA 51 | 10 20 30 40 50 | 1-MSE Chain B from PDB Type:PROTEIN Length:50 aligned with Q82T22_NITEU | Q82T22 from UniProtKB/TrEMBL Length:85 Alignment length:50 11 21 31 41 51 Q82T22_NITEU 2 HVWPVQDAKARFSEFLDACITEGPQIVSRRGAEEAVLVPIGEWRRLQAAA 51 SCOP domains d2odkb_ B: Hypothetical protein NE2111 SCOP domains CATH domains 2odkB00 B:2-51 YefM-like domain CATH domains Pfam domains -------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------- PROSITE Transcript -------------------------------------------------- Transcript 2odk B 2 HVWPVQDAKARFSEFLDACITEGPQIVSRRGAEEAVLVPIGEWRRLQAAA 51 11 21 31 41 51 Chain C from PDB Type:PROTEIN Length:51 aligned with Q82T22_NITEU | Q82T22 from UniProtKB/TrEMBL Length:85 Alignment length:51 10 20 30 40 50 Q82T22_NITEU 1 MHVWPVQDAKARFSEFLDACITEGPQIVSRRGAEEAVLVPIGEWRRLQAAA 51 SCOP domains d2odkc_ C: Hypothetical protein NE2111 SCOP domains CATH domains -2odkC00 C:2-51 YefM-like domain CATH domains Pfam domains --------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------- PROSITE Transcript --------------------------------------------------- Transcript 2odk C 1 mHVWPVQDAKARFSEFLDACITEGPQIVSRRGAEEAVLVPIGEWRRLQAAA 51 | 10 20 30 40 50 1-MSE Chain D from PDB Type:PROTEIN Length:52 aligned with Q82T22_NITEU | Q82T22 from UniProtKB/TrEMBL Length:85 Alignment length:52 1 | 9 19 29 39 49 Q82T22_NITEU - -MHVWPVQDAKARFSEFLDACITEGPQIVSRRGAEEAVLVPIGEWRRLQAAA 51 SCOP domains d2odkd_ D: Hypothetical protein NE2111 SCOP domains CATH domains 2odkD00 D:0-51 YefM-like domain CATH domains Pfam domains (1) -PhdYeFM_antitox-2odkD01 D:1-51 Pfam domains (1) Pfam domains (2) -PhdYeFM_antitox-2odkD02 D:1-51 Pfam domains (2) Pfam domains (3) -PhdYeFM_antitox-2odkD03 D:1-51 Pfam domains (3) Pfam domains (4) -PhdYeFM_antitox-2odkD04 D:1-51 Pfam domains (4) SAPs(SNPs) ---------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------- PROSITE Transcript ---------------------------------------------------- Transcript 2odk D 0 HmHVWPVQDAKARFSEFLDACITEGPQIVSRRGAEEAVLVPIGEWRRLQAAA 51 | 9 19 29 39 49 1-MSE
|
Asymmetric Unit |
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2ODK)
|
|
|
|
|
|
|