|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 14)| Asymmetric Unit (3, 14) Biological Unit 1 (2, 26) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2OCZ) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2OCZ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2OCZ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2OCZ) |
Exons (0, 0)| (no "Exon" information available for 2OCZ) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:218 aligned with AROD_STRP1 | P63590 from UniProtKB/Swiss-Prot Length:228 Alignment length:224 1 | 9 19 29 39 49 59 69 79 89 99 109 119 129 139 149 159 169 179 189 199 209 219 AROD_STRP1 - -MRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVFQEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLDHVSGPGQVTLNDMKRIIEVLE 223 SCOP domains d2ocza_ A: Type I 3-dehydroquinate dehydratase SCOP domains CATH domains 2oczA00 A:0-223 Aldolase class I CATH domains Pfam domains ----DHquinase_I-2oczA01 A:4-220 --- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2ocz A 0 AmRIVAPVmPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVFQEmLDFPNLILSYHNFEETPENLmEAFSEmTKLAPRVVKIAVmPQSEQDVLDLmNYTRGFKTLNPEQEFATISmGKLGRLSRFAGDVIGSSWTYVSL------GQVTLNDmKRIIEVLE 223 | |9 19 29 39 49 59 69 79 89 99 109 119 129 | 139 149 159 169 179 189 199 | 209 | 219 | 8-MSE 107-MSE 128-MSE | 147-MSE 158-MSE 178-MSE 201 208 | 1-MSE 134-MSE 215-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (6, 6)|
Asymmetric Unit(hide GO term definitions) Chain A (AROD_STRP1 | P63590)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|