2OAS - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF 4-HYDROXYBUTYRATE COENZYME A TRANSFERASE (ATOA) IN COMPLEX WITH COA FROM SHEWANELLA ONEIDENSIS, NORTHEAST STRUCTURAL GENOMICS TARGET SOR119.

Authors :   F. Forouhar, H. Neely, M. Hussain, J. Benach, J. Seetharaman, K. Cunnin L. C. Ma, L. Owen, Y. Fang, R. Xiao, J. Liu, M. C. Baran, T. B. Acton, G. T. Montelione, J. F. Hunt, L. Tong, Northeast Structural Genomic Consortium (Nesg)

Date :   17 Dec 06 (Deposition) - 23 Jan 07 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.40

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: A,B  (2x)

Keywords :   Alpha Beta Protein, Structural Genomics, Psi-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   F. Forouhar, H. Neely, M. Hussain, J. Benach, J. Seetharaman, K. Cunningham, L. C. Ma, L. Owen, Y. Fang, R. Xiao, J. Liu, M. C. Baran, T. B. Acton, G. T. Montelione, J. F. Hunt, L. Tong
Crystal Structure Of 4-Hydroxybutyrate Coenzyme A Transferase (Atoa) From Shewanella Oneidensis In Complex With Coa, Northeast Structural Genomics Target Sor119.
To Be Published
PubMed: search

Molecule 1 - 4-HYDROXYBUTYRATE COENZYME A TRANSFERASE
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET21
	Expression System Strain	:	BL21(DE3)+MAGIC
	Expression System Taxid	:	562
	Expression System Vector	:	BL21
	Expression System Vector Type	:	PLASMID
	Gene	:	CAT2, SO_1708
	Organism Scientific	:	SHEWANELLA ONEIDENSIS
	Organism Taxid	:	211586
	Strain	:	MR-1
	Synonym	:	ATOA

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (2x)	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 16)

No.	Name	Count	Type	Full Name
1	COA	2	Ligand/Ion	COENZYME A
2	MSE	14	Mod. Amino Acid	SELENOMETHIONINE

Biological Unit 1 (2, 16)

No.	Name	Count	Type	Full Name
1	COA	2	Ligand/Ion	COENZYME A
2	MSE	14	Mod. Amino Acid	SELENOMETHIONINE

Biological Unit 2 (2, 32)

No.	Name	Count	Type	Full Name
1	COA	4	Ligand/Ion	COENZYME A
2	MSE	28	Mod. Amino Acid	SELENOMETHIONINE

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	PHE A:76 , GLU A:233 , PHE A:264 , ALA A:307 , LEU A:308 , GLN A:309 , ALA A:318 , ILE A:321 , TYR A:326 , SER A:327 , GLY A:328 , VAL A:329 , GLY A:330 , GLY A:331 , GLN A:332 , ALA A:356 , ILE A:360 , ARG A:362 , HOH A:545 , HOH A:592 , ARG B:359	BINDING SITE FOR RESIDUE COA A 501
2	AC2	SOFTWARE	PHE B:76 , GLU B:233 , PHE B:264 , SER B:306 , ALA B:307 , LEU B:308 , ALA B:318 , ILE B:321 , TYR B:326 , SER B:327 , GLY B:328 , GLY B:330 , GLY B:331 , GLN B:332 , ALA B:356 , ARG B:362 , HOH B:508	BINDING SITE FOR RESIDUE COA B 501

(no "SS Bond" information available for 2OAS)

(no "Cis Peptide Bond" information available for 2OAS)

(no "SAP(SNP)/Variant" information available for 2OAS)

(no "PROSITE Motif" information available for 2OAS)

(no "Exon" information available for 2OAS)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:427
 aligned with Q8EG98_SHEON | Q8EG98 from UniProtKB/TrEMBL  Length:428

    Alignment length:427
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       
         Q8EG98_SHEON     2 PAIVCQSALEAVSLIRSGETLWTHSMGATPKVLLDALAKHALTLDNITLLQLHTEGAESLSHPSLLGHLRHRCFFGGVPTRPLLQSGDADYVPIFLSEVPKLFRSGEQKIDTAIIQVSPPDKHGMCSLGISVEATLAACQVAGKIIAHINPQMPRTHGDGFIHIDRFAAVYEQSASLPIHSFATGDAVSLAIGQHVAELVRDGDCLQMGIGAIPDAVLSCLTGHKDLGVHTELFSDGILQLVEKGVINNTKKRFYPGKLVTGFALGSQKLYDYVDDNPAVIFMDIEQVNDTSIIRKNPNVMAINSALQVDLTGQVCADSIGTKIYSGVGGQMDFIRGAGLSEGGRSVIALPSTAAGGRISRIASVLSPGAGVVTTRAHVHYIVTEYGAANLKGRSLRERAQALINIAHPDFREQLSRDAFEVWGLNL 428
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2oasA01 A:2-179 Glutaconate Coenzyme A-transferase                                                                                                                                2oasA02 A:180-283 4-hydroxybutyrate coenzyme  like domains                                              ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..ee..hhhhhhh......eeee.hhhhhhhhhhhhhhhhhhhh..eeeee.....hhhhhhhhhh..eeeee......hhhhhhh...ee...hhhhhhhhhhh......eeeeee.......eee......hhhhhhhhh.eeeeee.......ee..eee.hhh.eeee.............hhhhhhhhhhhhhhh....eee...hhhhhhhhhh.......ee...eehhhhhhhhhh..............eee.ee..hhhhhhhhh....eee.hhhhhhhhhhhh....eeeee...eee....ee..ee..ee.....hhhhhhhhhhhh...eeeee...ee....ee.ee........eee......eeee..eeee....hhhhhhhhhhh..hhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2oas A   2 PAIVCQSALEAVSLIRSGETLWTHSmGATPKVLLDALAKHALTLDNITLLQLHTEGAESLSHPSLLGHLRHRCFFGGVPTRPLLQSGDADYVPIFLSEVPKLFRSGEQKIDTAIIQVSPPDKHGmCSLGISVEATLAACQVAGKIIAHINPQmPRTHGDGFIHIDRFAAVYEQSASLPIHSFATGDAVSLAIGQHVAELVRDGDCLQmGIGAIPDAVLSCLTGHKDLGVHTELFSDGILQLVEKGVINNTKKRFYPGKLVTGFALGSQKLYDYVDDNPAVIFmDIEQVNDTSIIRKNPNVmAINSALQVDLTGQVCADSIGTKIYSGVGGQmDFIRGAGLSEGGRSVIALPSTAAGGRISRIASVLSPGAGVVTTRAHVHYIVTEYGAANLKGRSLRERAQALINIAHPDFREQLSRDAFEVWGLNL 428
                                    11        21     |  31        41        51        61        71        81        91       101       111       121    |  131       141       151  |    161       171       181       191       201       211       221       231       241       251       261       271       281  |    291       301|      311       321       331 |     341       351       361       371       381       391       401       411       421       
                                                    27-MSE                                                                                            126-MSE                     154-MSE                                                209-MSE                                                                    284-MSE           302-MSE                        333-MSE

Chain B from PDB  Type:PROTEIN  Length:427
 aligned with Q8EG98_SHEON | Q8EG98 from UniProtKB/TrEMBL  Length:428

    Alignment length:427
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       
         Q8EG98_SHEON     2 PAIVCQSALEAVSLIRSGETLWTHSMGATPKVLLDALAKHALTLDNITLLQLHTEGAESLSHPSLLGHLRHRCFFGGVPTRPLLQSGDADYVPIFLSEVPKLFRSGEQKIDTAIIQVSPPDKHGMCSLGISVEATLAACQVAGKIIAHINPQMPRTHGDGFIHIDRFAAVYEQSASLPIHSFATGDAVSLAIGQHVAELVRDGDCLQMGIGAIPDAVLSCLTGHKDLGVHTELFSDGILQLVEKGVINNTKKRFYPGKLVTGFALGSQKLYDYVDDNPAVIFMDIEQVNDTSIIRKNPNVMAINSALQVDLTGQVCADSIGTKIYSGVGGQMDFIRGAGLSEGGRSVIALPSTAAGGRISRIASVLSPGAGVVTTRAHVHYIVTEYGAANLKGRSLRERAQALINIAHPDFREQLSRDAFEVWGLNL 428
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2oasB01 B:2-179 Glutaconate Coenzyme A-transferase                                                                                                                                2oasB02 B:180-283 4-hydroxybutyrate coenzyme  like domains                                              ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ---AcetylCoA_hydro-2oasB03 B:5-180                                                                                                                                                 --------------------------------------------------------------------------------------AcetylCoA_hyd_C-2oasB01 B:267-420                                                                                                                         -------- Pfam domains (1)
           Pfam domains (2) ---AcetylCoA_hydro-2oasB04 B:5-180                                                                                                                                                 --------------------------------------------------------------------------------------AcetylCoA_hyd_C-2oasB02 B:267-420                                                                                                                         -------- Pfam domains (2)
         Sec.struct. author ..ee..hhhhhhh......eeee.hhhhhhhhhhhhhhhhhhhh..eeeee.....hhhhhhhhhh..eeeee......hhhhhhh...ee...hhhhhhhhhhh......eeeeee.......eee......hhhhhhhhh.eeeeee.......ee..eee.hhh.eeee.............hhhhhhhhhhhhh......eee...hhhhhhhhhh.......ee...eehhhhhhhhhh..............eee.ee..hhhhhhhhh....eee.hhhhhhhhhhhh....eeeee...eee....ee..ee..ee.....hhhhhhhhhhhh...eeeee...ee....ee.ee.................eeee..eeee....hhhhhhhhhhh..hhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2oas B   2 PAIVCQSALEAVSLIRSGETLWTHSmGATPKVLLDALAKHALTLDNITLLQLHTEGAESLSHPSLLGHLRHRCFFGGVPTRPLLQSGDADYVPIFLSEVPKLFRSGEQKIDTAIIQVSPPDKHGmCSLGISVEATLAACQVAGKIIAHINPQmPRTHGDGFIHIDRFAAVYEQSASLPIHSFATGDAVSLAIGQHVAELVRDGDCLQmGIGAIPDAVLSCLTGHKDLGVHTELFSDGILQLVEKGVINNTKKRFYPGKLVTGFALGSQKLYDYVDDNPAVIFmDIEQVNDTSIIRKNPNVmAINSALQVDLTGQVCADSIGTKIYSGVGGQmDFIRGAGLSEGGRSVIALPSTAAGGRISRIASVLSPGAGVVTTRAHVHYIVTEYGAANLKGRSLRERAQALINIAHPDFREQLSRDAFEVWGLNL 428
                                    11        21     |  31        41        51        61        71        81        91       101       111       121    |  131       141       151  |    161       171       181       191       201       211       221       231       241       251       261       271       281  |    291       301|      311       321       331 |     341       351       361       371       381       391       401       411       421       
                                                    27-MSE                                                                                            126-MSE                     154-MSE                                                209-MSE                                                                    284-MSE           302-MSE                        333-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2OAS)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: ISOCOT_Fold (53)

Family: AcetylCoA_hyd_C (2)

Shewanella oneidensis (1)

1a	AcetylCoA_hyd_C-2oasB01	B:267-420
1b	AcetylCoA_hyd_C-2oasB02	B:267-420

Family: AcetylCoA_hydro (2)

Shewanella oneidensis (1)

2a	AcetylCoA_hydro-2oasB03	B:5-180
2b	AcetylCoA_hydro-2oasB04	B:5-180

Asymmetric Unit(hide GO term definitions)

Chain A,B (Q8EG98_SHEON | Q8EG98)

molecular function
	GO:0008411	4-hydroxybutyrate CoA-transferase activity	Catalysis of the transfer of a coenzyme A (CoA) group to 4-hydroxybutyrate.
	GO:0008410	CoA-transferase activity	Catalysis of the transfer of a coenzyme A (CoA) group from one compound (donor) to another (acceptor).
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0006084	acetyl-CoA metabolic process	The chemical reactions and pathways involving acetyl-CoA, a derivative of coenzyme A in which the sulfhydryl group is acetylated; it is a metabolite derived from several pathways (e.g. glycolysis, fatty acid oxidation, amino-acid catabolism) and is further metabolized by the tricarboxylic acid cycle. It is a key intermediate in lipid and terpenoid biosynthesis.
	GO:0009061	anaerobic respiration	The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which uses compounds other than oxygen (e.g. nitrate, sulfate) as the terminal electron acceptor.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		COA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2oas)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2oas
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	Q8EG98_SHEON \| Q8EG98
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	Q8EG98_SHEON \| Q8EG98
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 2OAS)

(no "Related Entries Specified in the PDB File" available for 2OAS)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 16)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (2, 4)

Pfam Domains (2, 4)

Gene Ontology (8, 8)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File