2O53 - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF APO-ASPARTOACYLASE FROM HUMAN BRAIN

Authors :   J. Le Coq, A. Pavlovsky, R. Sanishvili, R. E. Viola

Date :   05 Dec 06 (Deposition) - 06 Nov 07 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.70

Chains :   Asym./Biol. Unit : A,B

Keywords :   Canavan Disease, N-Acetyl-L-Aspartate, Zinc-Dependent Hydrolase, Aspartoacylase Family, Aminoacylase-2, Acy2, Aspa, N- Phosphonomethyl-L-Aspartate, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Le Coq, A. Pavlovsky, R. Malik, R. Sanishvili, C. Xu, R. E. Viola
Examination Of The Mechanism Of Human Brain Aspartoacylase Through The Binding Of An Intermediate Analogue.
Biochemistry V. 47 3484 2008
PubMed-ID: 18293939 | Reference-DOI: 10.1021/BI702400X

Molecule 1 - ASPARTOACYLASE
	Chains	:	A, B
	EC Number	:	3.5.1.15
	Engineered	:	YES
	Expression System	:	PICHIA PASTORIS
	Expression System Plasmid	:	PPICZ A
	Expression System Strain	:	KM71H
	Expression System Taxid	:	4922
	Expression System Vector Type	:	PLASMID/HOMOLOGOUS RECOMBINATION
	Gene	:	ASPA, ACY2, ASP
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Strain	:	HUMAN
	Synonym	:	AMINOACYLASE-2, ACY-2

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 6)

No.	Name	Count	Type	Full Name
1	PO4	4	Ligand/Ion	PHOSPHATE ION
2	ZN	2	Ligand/Ion	ZINC ION

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	HIS A:21 , GLU A:24 , HIS A:116 , PO4 A:315	BINDING SITE FOR RESIDUE ZN A 314
2	AC2	SOFTWARE	HIS A:21 , GLU A:24 , ARG A:63 , HIS A:116 , ASN A:117 , GLU A:178 , TYR A:288 , ZN A:314 , PO4 A:316 , HOH A:319	BINDING SITE FOR RESIDUE PO4 A 315
3	AC3	SOFTWARE	HIS A:21 , ARG A:63 , ASP A:68 , ASN A:70 , TYR A:288 , PO4 A:315	BINDING SITE FOR RESIDUE PO4 A 316
4	AC4	SOFTWARE	HIS B:21 , GLU B:24 , HIS B:116 , PO4 B:315	BINDING SITE FOR RESIDUE ZN B 314
5	AC5	SOFTWARE	HIS B:21 , GLU B:24 , ARG B:63 , HIS B:116 , ASN B:117 , GLU B:178 , TYR B:288 , ZN B:314 , PO4 B:316	BINDING SITE FOR RESIDUE PO4 B 315
6	AC6	SOFTWARE	HIS B:21 , ARG B:63 , ASP B:68 , ASN B:70 , TYR B:164 , TYR B:288 , PO4 B:315	BINDING SITE FOR RESIDUE PO4 B 316

(no "SS Bond" information available for 2O53)

Asymmetric/Biological Unit

No.	Residues
1	Gly A:101	-	Pro A:102
2	Ala A:148	-	Pro A:149
3	Gly A:180	-	Pro A:181
4	Gly B:101	-	Pro B:102
5	Ala B:148	-	Pro B:149
6	His B:159	-	Pro B:160
7	Tyr B:164	-	Ala B:165
8	Gly B:180	-	Pro B:181
9	Asp B:266	-	Gly B:267

Asymmetric/Biological Unit (43, 86)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_039079	I	16	T	ACY2_HUMAN	Disease (CAND)	769653717	A/B	I	16	T
02	UniProt	VAR_016778	H	21	P	ACY2_HUMAN	Disease (CAND)	---	A/B	H	21	P
03	UniProt	VAR_016782	E	24	G	ACY2_HUMAN	Disease (CAND)	104894551	A/B	E	24	G
04	UniProt	VAR_078086	E	24	K	ACY2_HUMAN	Disease (CAND)	---	A/B	E	24	K
05	UniProt	VAR_039080	G	27	R	ACY2_HUMAN	Disease (CAND)	766328537	A/B	G	27	R
06	UniProt	VAR_078087	L	30	P	ACY2_HUMAN	Disease (CAND)	---	A/B	L	30	P
07	UniProt	VAR_016779	A	57	T	ACY2_HUMAN	Disease (CAND)	---	A/B	A	57	T
08	UniProt	VAR_078088	A	57	V	ACY2_HUMAN	Disease (CAND)	---	A/B	A	57	V
09	UniProt	VAR_078089	R	63	T	ACY2_HUMAN	Disease (CAND)	---	A/B	R	63	T
10	UniProt	VAR_016783	D	68	A	ACY2_HUMAN	Disease (CAND)	---	A/B	D	68	A
11	UniProt	VAR_078090	L	69	R	ACY2_HUMAN	Disease (CAND)	776777887	A/B	L	69	R
12	UniProt	VAR_078091	G	101	V	ACY2_HUMAN	Disease (CAND)	---	A/B	G	101	V
13	UniProt	VAR_039081	D	114	E	ACY2_HUMAN	Disease (CAND)	---	A/B	D	114	E
14	UniProt	VAR_016784	D	114	Y	ACY2_HUMAN	Disease (CAND)	---	A/B	D	114	Y
15	UniProt	VAR_039082	G	123	E	ACY2_HUMAN	Disease (CAND)	---	A/B	G	123	E
16	UniProt	VAR_078092	E	129	K	ACY2_HUMAN	Disease (CAND)	773049803	A/B	E	129	K
17	UniProt	VAR_004995	I	143	T	ACY2_HUMAN	Disease (CAND)	777936704	A/B	I	143	T
18	UniProt	VAR_004996	C	152	R	ACY2_HUMAN	Disease (CAND)	104894548	A/B	C	152	R
19	UniProt	VAR_016785	C	152	W	ACY2_HUMAN	Disease (CAND)	---	A/B	C	152	W
20	UniProt	VAR_039083	C	152	Y	ACY2_HUMAN	Disease (CAND)	---	A/B	C	152	Y
21	UniProt	VAR_039084	R	168	C	ACY2_HUMAN	Disease (CAND)	---	A/B	R	168	C
22	UniProt	VAR_016780	R	168	H	ACY2_HUMAN	Disease (CAND)	770706390	A/B	R	168	H
23	UniProt	VAR_078093	I	170	T	ACY2_HUMAN	Disease (CAND)	144321760	A/B	I	170	T
24	UniProt	VAR_078094	I	177	T	ACY2_HUMAN	Disease (CAND)	---	A/B	I	177	T
25	UniProt	VAR_078095	G	180	V	ACY2_HUMAN	Disease (CAND)	---	A/B	G	180	V
26	UniProt	VAR_016781	P	181	T	ACY2_HUMAN	Disease (CAND)	786204572	A/B	P	181	T
27	UniProt	VAR_039085	P	183	H	ACY2_HUMAN	Disease (CAND)	---	A/B	P	183	H
28	UniProt	VAR_039086	V	186	F	ACY2_HUMAN	Disease (CAND)	---	A/B	V	186	F
29	UniProt	VAR_039087	M	195	R	ACY2_HUMAN	Disease (CAND)	---	A/B	M	195	R
30	UniProt	VAR_078096	D	204	H	ACY2_HUMAN	Disease (CAND)	---	A/B	D	204	H
31	UniProt	VAR_016786	Y	231	C	ACY2_HUMAN	Disease (CAND)	104894550	A/B	Y	231	C
32	UniProt	VAR_016787	H	244	R	ACY2_HUMAN	Disease (CAND)	---	A/B	H	244	R
33	UniProt	VAR_078097	Q	248	R	ACY2_HUMAN	Disease (CAND)	---	A/B	Q	248	R
34	UniProt	VAR_016788	D	249	V	ACY2_HUMAN	Disease (CAND)	104894552	A/B	D	249	V
35	UniProt	VAR_004998	G	274	R	ACY2_HUMAN	Disease (CAND)	761064915	A/B	G	274	R
36	UniProt	VAR_039088	P	280	L	ACY2_HUMAN	Disease (CAND)	---	A/B	P	280	L
37	UniProt	VAR_039089	P	280	S	ACY2_HUMAN	Disease (CAND)	750505963	A/B	P	280	S
38	UniProt	VAR_004999	E	285	A	ACY2_HUMAN	Disease (CAND)	28940279	A/B	E	285	A
39	UniProt	VAR_078098	A	286	D	ACY2_HUMAN	Disease (CAND)	---	A/B	A	286	D
40	UniProt	VAR_039090	A	287	T	ACY2_HUMAN	Disease (CAND)	774323189	A/B	A	287	T
41	UniProt	VAR_005000	F	295	S	ACY2_HUMAN	Disease (CAND)	---	A/B	F	295	S
42	UniProt	VAR_005001	A	305	E	ACY2_HUMAN	Disease (CAND)	28940574	A/B	A	305	E
43	UniProt	VAR_039091	C	310	G	ACY2_HUMAN	Polymorphism	376854191	A/B	C	310	G

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 2O53)

Asymmetric/Biological Unit (6, 12)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2a	ENST00000263080	2a	ENSE00001116147	chr17:3379296-3379689	394	ACY2_HUMAN	1-79	79	2	A:9-79 B:9-79	71 71
1.3	ENST00000263080	3	ENSE00000669162	chr17:3384897-3385092	196	ACY2_HUMAN	79-144	66	2	A:79-144 B:79-144	66 66
1.4	ENST00000263080	4	ENSE00000669164	chr17:3386793-3386886	94	ACY2_HUMAN	145-176	32	2	A:145-176 B:145-176	32 32
1.5	ENST00000263080	5	ENSE00000669166	chr17:3392529-3392636	108	ACY2_HUMAN	176-212	37	2	A:176-212 B:176-212	37 37
1.6	ENST00000263080	6	ENSE00000669168	chr17:3397644-3397753	110	ACY2_HUMAN	212-248	37	2	A:212-248 B:212-248	37 37
1.7b	ENST00000263080	7b	ENSE00001923034	chr17:3402185-3406713	4529	ACY2_HUMAN	249-313	65	2	A:249-310 B:249-310	62 62

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:302
 aligned with ACY2_HUMAN | P45381 from UniProtKB/Swiss-Prot  Length:313

    Alignment length:302
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308  
           ACY2_HUMAN     9 EHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC 310
               SCOP domains d2o53a_ A: Aspartoacylase AspA                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee.....hhhhhhhhhhhh..hhhhh....eeeeee.hhhhhhh.......hhhhh.hhhhhh.......hhhhhhhhhhhhhhh.........eeeeeee.....eeeeee....hhhhhhhhhhhhhhhh...eeeee.........hhhhhh.eeeeeeee.......hhhhhhhhhhhhhhhhhhhhhhhh......eeeeeeeeeeee............ee................eeee.....eee.......eee...hhhhh.....eeeeeeeeeee..... Sec.struct. author
             SAPs(SNPs) (1) -------T----P--G--R--P--------------------------T-----T----AR-------------------------------V------------E--------E-----K-------------T--------R---------------C-T------T--VT-H--F--------R--------H--------------------------C------------R---RV------------------------R-----L----ADT-------S---------E----G SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------K--------------------------------V--------------------------------------------------------Y-------------------------------------W---------------H---------------------------------------------------------------------------------------------------------------S------------------------------ SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----------------------------------------------------------------------------------------------------------------------------------------------Y-------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: A:9-79 UniProt: 1-79 [INCOMPLETE]                      -----------------------------------------------------------------Exon 1.4  PDB: A:145-176        -----------------------------------Exon 1.6  PDB: A:212-248             Exon 1.7b  PDB: A:249-310 UniProt: 249-313 [INCOMPLETE]        Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------Exon 1.3  PDB: A:79-144 UniProt: 79-144                           -------------------------------Exon 1.5  PDB: A:176-212             -------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2o53 A   9 EHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC 310
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308

Chain B from PDB  Type:PROTEIN  Length:302
 aligned with ACY2_HUMAN | P45381 from UniProtKB/Swiss-Prot  Length:313

    Alignment length:302
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308  
           ACY2_HUMAN     9 EHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC 310
               SCOP domains d2o53b_ B: Aspartoacylase AspA                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee.....hhhhhhhhhhhhhhhhhhh....eeeeee.hhhhhhh.......hhhhh.hhhhhh.......hhhhhhhhhhhhhhh.........eeeeeee.....eeeeee....hhhhhhhhhhhhhhhh...eeeee.........hhhhhh.eeeeeeee.......hhhhhhhhhhhhhhhhhhhhhhhh......eeeeeeeeeeee............ee................eeee.....eee.......eee...hhhhh.....eeeeeeeeeee..... Sec.struct. author
             SAPs(SNPs) (1) -------T----P--G--R--P--------------------------T-----T----AR-------------------------------V------------E--------E-----K-------------T--------R---------------C-T------T--VT-H--F--------R--------H--------------------------C------------R---RV------------------------R-----L----ADT-------S---------E----G SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------K--------------------------------V--------------------------------------------------------Y-------------------------------------W---------------H---------------------------------------------------------------------------------------------------------------S------------------------------ SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----------------------------------------------------------------------------------------------------------------------------------------------Y-------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: B:9-79 UniProt: 1-79 [INCOMPLETE]                      -----------------------------------------------------------------Exon 1.4  PDB: B:145-176        -----------------------------------Exon 1.6  PDB: B:212-248             Exon 1.7b  PDB: B:249-310 UniProt: 249-313 [INCOMPLETE]        Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------Exon 1.3  PDB: B:79-144 UniProt: 79-144                           -------------------------------Exon 1.5  PDB: B:176-212             -------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2o53 B   9 EHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC 310
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: Phosphorylase/hydrolase-like (558)

Superfamily: Zn-dependent exopeptidases (214)

Family: AstE/AspA-like (10)

Protein domain: Aspartoacylase AspA (5)

Human (Homo sapiens) [TaxId: 9606] (4)

1a	d2o53a_	A:
1b	d2o53b_	B:

(no "CATH Domain" information available for 2O53)

(no "Pfam Domain" information available for 2O53)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (ACY2_HUMAN | P45381)

molecular function
	GO:0004046	aminoacylase activity	Catalysis of the reaction: an N-acyl-L-amino acid + H2O = a carboxylate + an L-amino acid.
	GO:0019807	aspartoacylase activity	Catalysis of the reaction: N-acyl-L-aspartate + H2O = a fatty acid anion + L-aspartate.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0016811	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides	Catalysis of the hydrolysis of any non-peptide carbon-nitrogen bond in a linear amide.
	GO:0016788	hydrolase activity, acting on ester bonds	Catalysis of the hydrolysis of any ester bond.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006533	aspartate catabolic process	The chemical reactions and pathways resulting in the breakdown of aspartate, the anion derived from aspartic acid, 2-aminobutanedioic acid.
	GO:0008652	cellular amino acid biosynthetic process	The chemical reactions and pathways resulting in the formation of amino acids, organic acids containing one or more amino substituents.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		PO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ala A:148 - Pro A:149	[ RasMol ]
		Ala B:148 - Pro B:149	[ RasMol ]
		Asp B:266 - Gly B:267	[ RasMol ]
		Gly A:101 - Pro A:102	[ RasMol ]
		Gly A:180 - Pro A:181	[ RasMol ]
		Gly B:101 - Pro B:102	[ RasMol ]
		Gly B:180 - Pro B:181	[ RasMol ]
		His B:159 - Pro B:160	[ RasMol ]
		Tyr B:164 - Ala B:165	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2o53
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ACY2_HUMAN \| P45381
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.5.1.15
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	271900
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ACY2_HUMAN \| P45381
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	ACY2_HUMAN \| P45381	:	2i3c 2o4h 2q51 4mri 4mxu 4nfr 4tnu

2o4h	COMPLEX CRYSTAL STRUCTURE OF HUMAN ASPARTOACYLASE WITH INTERMEDIATE ANALOG (N-PHOSPHONOMETHYL-L-ASPARTATE)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 6)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (9, 9)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (43, 86)

PROSITE Motifs (0, 0)

Exons (6, 12)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (14, 14)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File