Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF ZEBRAFISH APE
 
Authors :  M. M. Georgiadis, R. K. Gaur, S. Delaplane, J. Svenson
Date :  01 Dec 06  (Deposition) - 11 Dec 07  (Release) - 16 Jun 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Ape, Endonuclease, Dna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. M. Georgiadis, M. Luo, R. K. Gaur, S. Delaplane, X. Li, M. R. Kelley
Evolution Of The Redox Function In Mammalian Apurinic/Apyrimidinic Endonuclease
Mutat. Res. V. 643 54 2008
PubMed-ID: 18579163  |  Reference-DOI: 10.1016/J.MRFMMM.2008.04.008
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - APEX NUCLEASE 1
    ChainsA, B, C
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET15B
    Expression System StrainBL21(DE3) ROSETTA
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneAPEX1
    Organism CommonZEBRAFISH
    Organism ScientificDANIO RERIO
    Organism Taxid7955
    SynonymAPURINIC/APYRIMIDINIC ENDONUCLEASE

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 3)

Asymmetric/Biological Unit (1, 3)
No.NameCountTypeFull Name
1PB3Ligand/IonLEAD (II) ION

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLU B:131 , ASP C:63 , GLU C:89 , HOH C:424 , HOH C:454 , HOH C:464BINDING SITE FOR RESIDUE PB C 401
2AC2SOFTWAREASP A:63 , ALA A:67 , HOH A:438 , HOH A:453 , GLU C:131BINDING SITE FOR RESIDUE PB A 402
3AC3SOFTWAREASP B:63 , GLU B:89 , HOH B:473 , HOH B:514BINDING SITE FOR RESIDUE PB B 403

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2O3C)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2O3C)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2O3C)

(-) PROSITE Motifs  (3, 9)

Asymmetric/Biological Unit (3, 9)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1AP_NUCLEASE_F1_4PS51435 AP endonucleases family 1 profile.APEX1_DANRE55-310
 
 
  3A:55-310
B:55-310
C:55-310
2AP_NUCLEASE_F1_1PS00726 AP endonucleases family 1 signature 1.APEX1_DANRE82-91
 
 
  3A:82-91
B:82-91
C:82-91
3AP_NUCLEASE_F1_3PS00728 AP endonucleases family 1 signature 3.APEX1_DANRE269-280
 
 
  3A:269-280
B:269-280
C:269-280

(-) Exons   (0, 0)

(no "Exon" information available for 2O3C)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:276
 aligned with APEX1_DANRE | A0MTA1 from UniProtKB/Swiss-Prot  Length:310

    Alignment length:276
                                    44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304      
          APEX1_DANRE    35 PILYEDPPEKLTSKDGRAANMKITSWNVDGLRAWVKKNGLDWVRKEDPDILCLQETKCAEKALPADITGMPEYPHKYWAGSEDKEGYSGVAMLCKTEPLNVTYGIGKEEHDKEGRVITAEFPDFFLVTAYVPNASRGLVRLDYRKTWDVDFRAYLCGLDARKPLVLCGDLNVAHQEIDLKNPKGNRKNAGFTPEEREGFTQLLEAGFTDSFRELYPDQAYAYTFWTYMMNARSKNVGWRLDYFVLSSALLPGLCDSKIRNTAMGSDHCPITLFLAV 310
               SCOP domains d2o3ca_ A: automated matches                                                                                                                                                                                                                                                         SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....................eeeeeee..hhhhhhhhhhhhhhhhhh..eeeee....hhhhhhhhhhh.....eeeee..........eeeee.....eeee............eeeee....eeeeee....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee.....hhhhh.hhhhhh.....hhhhhhhhhhhhhh.eeehhhhhh...........hhhhhhhhh.....eeeeee.hhhh.eeeeee...........eeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) --------------------AP_NUCLEASE_F1_4  PDB: A:55-310 UniProt: 55-310                                                                                                                                                                                                                  PROSITE (1)
                PROSITE (2) -----------------------------------------------AP_NUCLEAS---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AP_NUCLEASE_------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2o3c A  35 PILYEDPPEKLTSKDGRAANMKITSWNVDGLRAWVKKNGLDWVRKEDPDILCLQETKCAEKALPADITAMPEYPHKYWAGSEDKEGYSGVAMLCKTEPLNVTYGIGKEEHDKEGRVITAEFPDFFLVTAYVPNASRGLVRLDYRKTWDVDFRAYLCGLDARKPLVLCGDLNVAHQEIDLKNPKGNRKNAGFTPEEREGFTQLLEAGFTDSFRELYPDQAYAYTFWTYMMNARSKNVGWRLDYFVLSSALLPGLCDSKIRNTAMGSDHCPITLFLAV 310
                                    44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304      

Chain B from PDB  Type:PROTEIN  Length:280
 aligned with APEX1_DANRE | A0MTA1 from UniProtKB/Swiss-Prot  Length:310

    Alignment length:280
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310
          APEX1_DANRE    31 EPEAPILYEDPPEKLTSKDGRAANMKITSWNVDGLRAWVKKNGLDWVRKEDPDILCLQETKCAEKALPADITGMPEYPHKYWAGSEDKEGYSGVAMLCKTEPLNVTYGIGKEEHDKEGRVITAEFPDFFLVTAYVPNASRGLVRLDYRKTWDVDFRAYLCGLDARKPLVLCGDLNVAHQEIDLKNPKGNRKNAGFTPEEREGFTQLLEAGFTDSFRELYPDQAYAYTFWTYMMNARSKNVGWRLDYFVLSSALLPGLCDSKIRNTAMGSDHCPITLFLAV 310
               SCOP domains d2o3cb_ B: automated matches                                                                                                                                                                                                                                                             SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........................eeeeeee..hhhhhhhhhhhhhhhhhh..eeeee....hhhhhhhhhhh.....eeeee..hhhhh...eeeee.....eeee............eeeee....eeeeee....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee.....hhhhh.hhhhhh.....hhhhhhhhhhhhh..eeehhhhhh...........hhhhhhhhh.....eeeeee.hhhh.eeeeee...........eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------------------AP_NUCLEASE_F1_4  PDB: B:55-310 UniProt: 55-310                                                                                                                                                                                                                  PROSITE (1)
                PROSITE (2) ---------------------------------------------------AP_NUCLEAS---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AP_NUCLEASE_------------------------------ PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2o3c B  31 HMEAPILYEDPPEKLTSKDGRAANMKITSWNVDGLRAWVKKNGLDWVRKEDPDILCLQETKCAEKALPADITAMPEYPHKYWAGSEDKEGYSGVAMLCKTEPLNVTYGIGKEEHDKEGRVITAEFPDFFLVTAYVPNASRGLVRLDYRKTWDVDFRAYLCGLDARKPLVLCGDLNVAHQEIDLKNPKGNRKNAGFTPEEREGFTQLLEAGFTDSFRELYPDQAYAYTFWTYMMNARSKNVGWRLDYFVLSSALLPGLCDSKIRNTAMGSDHCPITLFLAV 310
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310

Chain C from PDB  Type:PROTEIN  Length:276
 aligned with APEX1_DANRE | A0MTA1 from UniProtKB/Swiss-Prot  Length:310

    Alignment length:276
                                    44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304      
          APEX1_DANRE    35 PILYEDPPEKLTSKDGRAANMKITSWNVDGLRAWVKKNGLDWVRKEDPDILCLQETKCAEKALPADITGMPEYPHKYWAGSEDKEGYSGVAMLCKTEPLNVTYGIGKEEHDKEGRVITAEFPDFFLVTAYVPNASRGLVRLDYRKTWDVDFRAYLCGLDARKPLVLCGDLNVAHQEIDLKNPKGNRKNAGFTPEEREGFTQLLEAGFTDSFRELYPDQAYAYTFWTYMMNARSKNVGWRLDYFVLSSALLPGLCDSKIRNTAMGSDHCPITLFLAV 310
               SCOP domains d2o3cc_ C: automated matches                                                                                                                                                                                                                                                         SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....................eeeeeee..hhhhhhhhhhhhhhhhhh..eeeee....hhhhhhhhhhh.....eeeee..........eeeee.....eeee...hhhhhh...eeeee....eeeeee....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee.....hhhhh..hhhhh.....hhhhhhhhhhhhhh.eeehhhhhh...........hhhhh.........eeeeee.hhhh.eeeeee...........eeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) --------------------AP_NUCLEASE_F1_4  PDB: C:55-310 UniProt: 55-310                                                                                                                                                                                                                  PROSITE (1)
                PROSITE (2) -----------------------------------------------AP_NUCLEAS---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AP_NUCLEASE_------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2o3c C  35 PILYEDPPEKLTSKDGRAANMKITSWNVDGLRAWVKKNGLDWVRKEDPDILCLQETKCAEKALPADITAMPEYPHKYWAGSEDKEGYSGVAMLCKTEPLNVTYGIGKEEHDKEGRVITAEFPDFFLVTAYVPNASRGLVRLDYRKTWDVDFRAYLCGLDARKPLVLCGDLNVAHQEIDLKNPKGNRKNAGFTPEEREGFTQLLEAGFTDSFRELYPDQAYAYTFWTYMMNARSKNVGWRLDYFVLSSALLPGLCDSKIRNTAMGSDHCPITLFLAV 310
                                    44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2O3C)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2O3C)

(-) Gene Ontology  (26, 26)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C   (APEX1_DANRE | A0MTA1)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003906    DNA-(apurinic or apyrimidinic site) lyase activity    Catalysis of the cleavage of the C-O-P bond 3' to the apurinic or apyrimidinic site in DNA by a beta-elimination reaction, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate.
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0008311    double-stranded DNA 3'-5' exodeoxyribonuclease activity    Catalysis of the sequential cleavage of mononucleotides from a free 3' terminus of a double-stranded DNA molecule.
    GO:0004519    endonuclease activity    Catalysis of the hydrolysis of ester linkages within nucleic acids by creating internal breaks.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016829    lyase activity    Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0004518    nuclease activity    Catalysis of the hydrolysis of ester linkages within nucleic acids.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0080111    DNA demethylation    The removal of a methyl group from one or more nucleotides within an DNA molecule.
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006284    base-excision repair    In base excision repair, an altered base is removed by a DNA glycosylase enzyme, followed by excision of the resulting sugar phosphate. The small gap left in the DNA helix is filled in by the sequential action of DNA polymerase and DNA ligase.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0060047    heart contraction    The multicellular organismal process in which the heart decreases in volume in a characteristic way to propel blood through the body.
    GO:0001947    heart looping    The tube morphogenesis process in which the primitive heart tube loops asymmetrically. This looping brings the primitive heart chambers into alignment preceding their future integration. Heart looping begins with dextral-looping and ends when the main regional divisions of the mature heart and primordium of the great arterial trunks become established preceeding septation.
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:0090305    nucleic acid phosphodiester bond hydrolysis    The nucleic acid metabolic process in which the phosphodiester bonds between nucleotides are cleaved by hydrolysis.
    GO:0010628    positive regulation of gene expression    Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005783    endoplasmic reticulum    The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0016607    nuclear speck    A discrete extra-nucleolar subnuclear domain, 20-50 in number, in which splicing factors are seen to be localized by immunofluorescence microscopy.
    GO:0005730    nucleolus    A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    PB  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2o3c)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2o3c
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  APEX1_DANRE | A0MTA1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  APEX1_DANRE | A0MTA1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2O3C)

(-) Related Entries Specified in the PDB File

2o3h