|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2NUL) |
Sites (0, 0)| (no "Site" information available for 2NUL) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2NUL) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2NUL) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2NUL) |
PROSITE Motifs (2, 2)
Asymmetric Unit (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2NUL) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:163 aligned with PPIB_ECOLI | P23869 from UniProtKB/Swiss-Prot Length:164 Alignment length:163 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 PPIB_ECOLI 1 MVTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGFYNNTIFHRVINGFMIQGGGFEPGMKQKATKEPIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVVDNDFLNFSGESLQGWGYCVFAEVVDGMDVVDKIKGVATGRSGMHQDVPKEDVIIESVTVS 163 SCOP domains d2nula_ A: Peptidyl-prolyl cis-trans isomerase A, PpiA SCOP domains CATH domains 2nulA00 A:1-163 Cyclophilin CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) CSA_PPIASE_2 PDB: A:1-162 UniProt: 1-162 - PROSITE (1) PROSITE (2) -----------------------------------CSA_PPIASE_1 -------------------------------------------------------------------------------------------------------------- PROSITE (2) Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2nul A 1 MVTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGFYNNTIFHRVINGFMIQGGGFEPGMKQKATKEPIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVVDNDFLNFSGESLQGWGYCVFAEVVDGMDVVDKIKGVATGRSGMHQDVPKEDVIIESVTVS 163 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2NUL) |
Gene Ontology (7, 7)|
Asymmetric Unit(hide GO term definitions) Chain A (PPIB_ECOLI | P23869)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|