Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF IRAK-4
 
Authors :  Z. Wang, J. Liu, N. P. C. Walker
Date :  02 Nov 06  (Deposition) - 12 Dec 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.15
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Kinase, Inhibitor, Staurosporine, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Z. Wang, J. Liu, A. Sudom, M. Ayres, S. Li, H. Wesche, J. P. Powers, N. P. C. Walker
Crystal Structures Of Irak-4 Kinase In Complex With Inhibitors: A Serine/Threonine Kinase With Tyrosine As A Gatekeeper.
Structure V. 14 1835 2006
PubMed-ID: 17161373  |  Reference-DOI: 10.1016/J.STR.2006.11.001
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    ChainsA, B, C, D
    EC Number2.7.11.1
    EngineeredYES
    Expression SystemUNIDENTIFIED BACULOVIRUS
    Expression System Taxid10469
    FragmentPROTEIN KINASE
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymIRAK-4, NY- REN-64 ANTIGEN

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A   
Biological Unit 2 (1x) B  
Biological Unit 3 (1x)  C 
Biological Unit 4 (1x)   D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 8)

Asymmetric Unit (2, 8)
No.NameCountTypeFull Name
1STU4Ligand/IonSTAUROSPORINE
2TPO4Mod. Amino AcidPHOSPHOTHREONINE
Biological Unit 1 (2, 2)
No.NameCountTypeFull Name
1STU1Ligand/IonSTAUROSPORINE
2TPO1Mod. Amino AcidPHOSPHOTHREONINE
Biological Unit 2 (2, 2)
No.NameCountTypeFull Name
1STU1Ligand/IonSTAUROSPORINE
2TPO1Mod. Amino AcidPHOSPHOTHREONINE
Biological Unit 3 (2, 2)
No.NameCountTypeFull Name
1STU1Ligand/IonSTAUROSPORINE
2TPO1Mod. Amino AcidPHOSPHOTHREONINE
Biological Unit 4 (2, 2)
No.NameCountTypeFull Name
1STU1Ligand/IonSTAUROSPORINE
2TPO1Mod. Amino AcidPHOSPHOTHREONINE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLU D:194 , VAL D:200 , ALA D:211 , TYR D:262 , VAL D:263 , TYR D:264 , MET D:265 , GLY D:268 , ALA D:315 , ASN D:316 , LEU D:318 , SER D:328 , HOH D:555BINDING SITE FOR RESIDUE STU D 501
2AC2SOFTWAREMET B:192 , GLU B:194 , GLY B:195 , VAL B:200 , ALA B:211 , LYS B:213 , TYR B:262 , VAL B:263 , TYR B:264 , MET B:265 , GLY B:268 , ALA B:315 , ASN B:316 , LEU B:318 , SER B:328BINDING SITE FOR RESIDUE STU B 502
3AC3SOFTWAREMET C:192 , GLY C:193 , GLU C:194 , GLY C:195 , VAL C:200 , ALA C:211 , LYS C:213 , TYR C:262 , VAL C:263 , TYR C:264 , MET C:265 , GLY C:268 , ALA C:315 , ASN C:316 , LEU C:318 , SER C:328 , HOH C:549BINDING SITE FOR RESIDUE STU C 503
4AC4SOFTWAREMET A:192 , GLY A:193 , GLU A:194 , GLY A:195 , VAL A:200 , ALA A:211 , LYS A:213 , TYR A:262 , VAL A:263 , TYR A:264 , MET A:265 , GLY A:268 , ALA A:315 , ASN A:316 , LEU A:318 , SER A:328 , HOH A:590BINDING SITE FOR RESIDUE STU A 504

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2NRY)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Glu A:392 -Pro A:393
2Glu B:392 -Pro B:393
3Glu C:392 -Pro C:393
4Glu D:392 -Pro D:393

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (5, 20)

Asymmetric Unit (5, 20)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_072892G298DIRAK4_HUMANDisease (IRAK4D)568782766A/B/C/DG298D
2UniProtVAR_040589M355VIRAK4_HUMANPolymorphism142376871A/B/C/DM355V
3UniProtVAR_019355H390RIRAK4_HUMANPolymorphism4251583A/B/C/DH390R
4UniProtVAR_040590R391HIRAK4_HUMANPolymorphism55944915A/B/C/DR391H
5UniProtVAR_019356A428TIRAK4_HUMANPolymorphism4251545A/B/C/DA428T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (5, 5)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_072892G298DIRAK4_HUMANDisease (IRAK4D)568782766AG298D
2UniProtVAR_040589M355VIRAK4_HUMANPolymorphism142376871AM355V
3UniProtVAR_019355H390RIRAK4_HUMANPolymorphism4251583AH390R
4UniProtVAR_040590R391HIRAK4_HUMANPolymorphism55944915AR391H
5UniProtVAR_019356A428TIRAK4_HUMANPolymorphism4251545AA428T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (5, 5)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_072892G298DIRAK4_HUMANDisease (IRAK4D)568782766BG298D
2UniProtVAR_040589M355VIRAK4_HUMANPolymorphism142376871BM355V
3UniProtVAR_019355H390RIRAK4_HUMANPolymorphism4251583BH390R
4UniProtVAR_040590R391HIRAK4_HUMANPolymorphism55944915BR391H
5UniProtVAR_019356A428TIRAK4_HUMANPolymorphism4251545BA428T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (5, 5)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_072892G298DIRAK4_HUMANDisease (IRAK4D)568782766CG298D
2UniProtVAR_040589M355VIRAK4_HUMANPolymorphism142376871CM355V
3UniProtVAR_019355H390RIRAK4_HUMANPolymorphism4251583CH390R
4UniProtVAR_040590R391HIRAK4_HUMANPolymorphism55944915CR391H
5UniProtVAR_019356A428TIRAK4_HUMANPolymorphism4251545CA428T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 4 (5, 5)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_072892G298DIRAK4_HUMANDisease (IRAK4D)568782766DG298D
2UniProtVAR_040589M355VIRAK4_HUMANPolymorphism142376871DM355V
3UniProtVAR_019355H390RIRAK4_HUMANPolymorphism4251583DH390R
4UniProtVAR_040590R391HIRAK4_HUMANPolymorphism55944915DR391H
5UniProtVAR_019356A428TIRAK4_HUMANPolymorphism4251545DA428T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2NRY)

(-) Exons   (0, 0)

(no "Exon" information available for 2NRY)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:287
 aligned with IRAK4_HUMAN | Q9NWZ3 from UniProtKB/Swiss-Prot  Length:460

    Alignment length:295
                                   173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453     
          IRAK4_HUMAN   164 RFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMT 458
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2nryA01 A:164-264 Phosphorylase Kinase; domain 1                                                     2nryA02 A:265-458 Transferase(Phosphotransferase) domain 1                                                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeehhhhhhhhh......hhhhh..eeeee..eeeeeeee..eeeeeeee..---...hhhhhhhhhhhhhhhhh.......eeeee......eeeee.....hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee.........-----.........hhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhh..hhhhh........hhhhhhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------D--------------------------------------------------------V----------------------------------RH------------------------------------T------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2nry A 164 RFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAA---ITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARAS-----TVMtSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMT 458
                                   173       183       193       203       213   |   223       233       243       253       263       273       283       293       303       313       323       333  |    343 |     353       363       373       383       393       403       413       423       433       443       453     
                                                                               217 221                                                                                                                336   342  |                                                                                                                 
                                                                                                                                                                                                               345-TPO                                                                                                             

Chain B from PDB  Type:PROTEIN  Length:287
 aligned with IRAK4_HUMAN | Q9NWZ3 from UniProtKB/Swiss-Prot  Length:460

    Alignment length:295
                                   173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453     
          IRAK4_HUMAN   164 RFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMT 458
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2nryB01 B:164-264 Phosphorylase Kinase; domain 1                                                     2nryB02 B:265-458 Transferase(Phosphotransferase) domain 1                                                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeehhhhhhhhh......hhhhh..eeee...eeeeeeee..eeeeeeee..---.hhhhhhhhhhhhhhhhhhh.......eeeee......eeeee....eehhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee.-----.ee......hhhhhhhhhhh.ee.hhhhhhhhhhhhhhhhhh............hhhhhhhhhh................hhhhhhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------D--------------------------------------------------------V----------------------------------RH------------------------------------T------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2nry B 164 RFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAA---ITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARAS-----TVMtSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMT 458
                                   173       183       193       203       213   |   223       233       243       253       263       273       283       293       303       313       323       333  |    343 |     353       363       373       383       393       403       413       423       433       443       453     
                                                                               217 221                                                                                                                336   342  |                                                                                                                 
                                                                                                                                                                                                               345-TPO                                                                                                             

Chain C from PDB  Type:PROTEIN  Length:281
 aligned with IRAK4_HUMAN | Q9NWZ3 from UniProtKB/Swiss-Prot  Length:460

    Alignment length:295
                                   173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453     
          IRAK4_HUMAN   164 RFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMT 458
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2nryC01 C:164-264 Phosphorylase Kinase; domain 1                                                     2nryC02 C:265-458 Transferase(Phosphotransferase) domain 1                                                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..ee.hhhhhhhhh.............eeeee..eeeeeee....eeeeee.----------hhhhhhhhhhhhhhh.......eeeee......eeeee.....hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee.........----..........hhhhhhhhhhh....hhhhhhhhhhhhhhhhhh...........hhhhhhhhhhh...hhhhh........hhhhhhhhhhhhhhhh........hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------D--------------------------------------------------------V----------------------------------RH------------------------------------T------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2nry C 164 RFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKL----------LKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARAS----QTVMtSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMT 458
                                   173       183       193       203       213 |       -  |    233       243       253       263       273       283       293       303       313       323       333  |    343 |     353       363       373       383       393       403       413       423       433       443       453     
                                                                             215        226                                                                                                           336  341   |                                                                                                                 
                                                                                                                                                                                                               345-TPO                                                                                                             

Chain D from PDB  Type:PROTEIN  Length:283
 aligned with IRAK4_HUMAN | Q9NWZ3 from UniProtKB/Swiss-Prot  Length:460

    Alignment length:297
                                   173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       
          IRAK4_HUMAN   164 RFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS 460
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2nryD01 D:164-264 Phosphorylase Kinase; domain 1                                                     2nryD02 D:265-460 Transferase(Phosphotransferase) domain 1                                                                                                                                           CATH domains
           Pfam domains (1) -----------------------Pkinase-2nryD01 D:187-455                                                                                                                                                                                                                                                    ----- Pfam domains (1)
           Pfam domains (2) -----------------------Pkinase-2nryD02 D:187-455                                                                                                                                                                                                                                                    ----- Pfam domains (2)
           Pfam domains (3) -----------------------Pkinase-2nryD03 D:187-455                                                                                                                                                                                                                                                    ----- Pfam domains (3)
           Pfam domains (4) -----------------------Pkinase-2nryD04 D:187-455                                                                                                                                                                                                                                                    ----- Pfam domains (4)
         Sec.struct. author ..ee.hhhhhhhhh.............eeee....eeeee......eeeee.---------hhhhhhhhhhhhhhhh.......eeeee......eeeee.....hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee..-----........hhhhhhhhhhh....hhhhhhhhhhhhhhhhhh...........hhhhhhhhhhh...hhhhh........hhhhhhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------D--------------------------------------------------------V----------------------------------RH------------------------------------T-------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2nry D 164 RFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKL---------ELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASE-----VMtSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS 460
                                   173       183       193       203       213 |       - |     233       243       253       263       273       283       293       303       313       323       333   |   343 |     353       363       373       383       393       403       413       423       433       443       453       
                                                                             215       225                                                                                                             337   343 |                                                                                                                   
                                                                                                                                                                                                               345-TPO                                                                                                               

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2NRY)

(-) CATH Domains  (2, 8)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 4)

Asymmetric Unit
(-)
Clan: PKinase (934)
(-)
Family: Pkinase (680)
1aPkinase-2nryD01D:187-455
1bPkinase-2nryD02D:187-455
1cPkinase-2nryD03D:187-455
1dPkinase-2nryD04D:187-455

(-) Gene Ontology  (30, 30)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (IRAK4_HUMAN | Q9NWZ3)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0005149    interleukin-1 receptor binding    Interacting selectively and non-covalently with the interleukin-1 receptor.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0000287    magnesium ion binding    Interacting selectively and non-covalently with magnesium (Mg) ions.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004674    protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0007254    JNK cascade    An intracellular protein kinase cascade containing at least a JNK (a MAPK), a JNKK (a MAPKK) and a JUN3K (a MAP3K). The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
    GO:0002755    MyD88-dependent toll-like receptor signaling pathway    Any series of molecular signals generated as a consequence of binding to a toll-like receptor where the MyD88 adaptor molecule mediates transduction of the signal. Toll-like receptors directly bind pattern motifs from a variety of microbial sources to initiate innate immune response.
    GO:0001816    cytokine production    The appearance of a cytokine due to biosynthesis or secretion following a cellular stimulus, resulting in an increase in its intracellular or extracellular levels.
    GO:0019221    cytokine-mediated signaling pathway    A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0002376    immune system process    Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:0002446    neutrophil mediated immunity    Any process involved in the carrying out of an immune response by a neutrophil.
    GO:1990266    neutrophil migration    The movement of an neutrophil within or between different tissues and organs of the body.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0043123    positive regulation of I-kappaB kinase/NF-kappaB signaling    Any process that activates or increases the frequency, rate or extent of I-kappaB kinase/NF-kappaB signaling.
    GO:0048661    positive regulation of smooth muscle cell proliferation    Any process that activates or increases the rate or extent of smooth muscle cell proliferation.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0034162    toll-like receptor 9 signaling pathway    Any series of molecular signals generated as a consequence of binding to toll-like receptor 9.
    GO:0002224    toll-like receptor signaling pathway    Any series of molecular signals generated as a consequence of binding to a toll-like receptor. Toll-like receptors directly bind pattern motifs from a variety of microbial sources to initiate innate immune response.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0010008    endosome membrane    The lipid bilayer surrounding an endosome.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    STU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TPO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:392 - Pro A:393   [ RasMol ]  
    Glu B:392 - Pro B:393   [ RasMol ]  
    Glu C:392 - Pro C:393   [ RasMol ]  
    Glu D:392 - Pro D:393   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2nry
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IRAK4_HUMAN | Q9NWZ3
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  607676
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  IRAK4_HUMAN | Q9NWZ3
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IRAK4_HUMAN | Q9NWZ32nru 2o8y 2oib 2oic 2oid 3mop 4rmz 4u97 4u9a 4xs2 4y73 4yo6 4yp8 4ztl 4ztm 4ztn 5kx7 5kx8 5t1s 5t1t 5uiq 5uir 5uis 5uit 5uiu

(-) Related Entries Specified in the PDB File

2nru