Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  STRUCTURAL STUDIES ON PLASMODIUM VIVAX MEROZOITE SURFACE PROTEIN-1
 
Authors :  J. J. Babon, W. D. Morgan, G. Kelly, J. F. Eccleston, J. Feeney, A. A. Holder
Date :  29 Oct 06  (Deposition) - 20 Mar 07  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Egf-Like Domain, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. J. Babon, W. D. Morgan, G. Kelly, J. F. Eccleston, J. Feeney, A. A. Holder
Structural Studies On Plasmodium Vivax Merozoite Surface Protein-1
Mol. Biochem. Parasitol. V. 153 31 2007
PubMed-ID: 17343930  |  Reference-DOI: 10.1016/J.MOLBIOPARA.2007.01.015
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - MEROZOITE SURFACE PROTEIN 1
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET-30XA/LIC
    Expression System StrainBL21 (DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentC-TERMINAL DOMAIN, RESIDUES 1-90
    GeneMSP1
    Organism ScientificPLASMODIUM VIVAX (STRAIN BELEM)
    Organism Taxid31273
    StrainBELEM

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2NPR)

(-) Sites  (0, 0)

(no "Site" information available for 2NPR)

(-) SS Bonds  (5, 5)

NMR Structure
No.Residues
1A:8 -A:19
2A:31 -A:42
3A:50 -A:63
4A:57 -A:73
5A:75 -A:89

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2NPR)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2NPR)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2NPR)

(-) Exons   (0, 0)

(no "Exon" information available for 2NPR)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:90
 aligned with Q2I7F0_PLAVI | Q2I7F0 from UniProtKB/TrEMBL  Length:1746

    Alignment length:90
                                  1644      1654      1664      1674      1684      1694      1704      1714      1724
        Q2I7F0_PLAVI   1635 TMSSEHTCIDTNVPDNAACYRYLDGTEEWRCLLTFKEEGGKCVPASNVTCKDNNGGCAPEAECKMTDSNKIVCKCTKEGSEPLFEGVFCS 1724
               SCOP domains d2npra1 A:1-46                                d2npra2 A:47-90                              SCOP domains
               CATH domains 2nprA01 A:1-52 Laminin                              2nprA02 A:53-90 Laminin                CATH domains
               Pfam domains ------EGF_MSP1_1-2nprA02 A:7-43            ------EGF_3-2nprA01 A:50-89                   - Pfam domains
         Sec.struct. author ................eeee.......eeee...eee....eee................eeeee.....eeeee.....ee......ee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------ Transcript
                2npr A    1 TMSSEHTCIDTNVPDNAACYRYLDGTEEWRCLLTFKEEGGKCVPASNVTCKDNNGGCAPEAECKMTDSNKIVCKCTKEGSEPLFEGVFCS   90
                                    10        20        30        40        50        60        70        80        90

Chain A from PDB  Type:PROTEIN  Length:90
 aligned with Q8I1L1_PLAVI | Q8I1L1 from UniProtKB/TrEMBL  Length:1769

    Alignment length:90
                                  1667      1677      1687      1697      1707      1717      1727      1737      1747
        Q8I1L1_PLAVI   1658 TMSSEHTCIDTNVPDNAACYRYLDGTEEWRCLLTFKEEGGKCVPASNVTCKDNNGGCAPEAECKMTDSNKIVCKCTKEGSEPLFEGVFCS 1747
               SCOP domains d2npra1 A:1-46                                d2npra2 A:47-90                              SCOP domains
               CATH domains 2nprA01 A:1-52 Laminin                              2nprA02 A:53-90 Laminin                CATH domains
               Pfam domains ------EGF_MSP1_1-2nprA02 A:7-43            ------EGF_3-2nprA01 A:50-89                   - Pfam domains
         Sec.struct. author ................eeee.......eeee...eee....eee................eeeee.....eeeee.....ee......ee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------ Transcript
                2npr A    1 TMSSEHTCIDTNVPDNAACYRYLDGTEEWRCLLTFKEEGGKCVPASNVTCKDNNGGCAPEAECKMTDSNKIVCKCTKEGSEPLFEGVFCS   90
                                    10        20        30        40        50        60        70        80        90

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

NMR Structure

(-) CATH Domains  (1, 2)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (2, 2)

NMR Structure
(-)
Clan: EGF (60)

(-) Gene Ontology  (3, 6)

NMR Structure(hide GO term definitions)
Chain A   (Q2I7F0_PLAVI | Q2I7F0)
biological process
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Chain A   (Q8I1L1_PLAVI | Q8I1L1)
biological process
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2npr)
 
  Sites
(no "Sites" information available for 2npr)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2npr)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2npr
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q2I7F0_PLAVI | Q2I7F0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  Q8I1L1_PLAVI | Q8I1L1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q2I7F0_PLAVI | Q2I7F0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q8I1L1_PLAVI | Q8I1L1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2NPR)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2NPR)