|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 3)
NMR Structure (1, 3)
|
Sites (3, 3)
NMR Structure (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2MZ9) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2MZ9) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2MZ9) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2MZ9) |
Exons (0, 0)| (no "Exon" information available for 2MZ9) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:71 aligned with Q8GGK7_GEOSN | Q8GGK7 from UniProtKB/TrEMBL Length:91 Alignment length:71 30 40 50 60 70 80 90 Q8GGK7_GEOSN 21 ADDIVLKAKNGDVKFPHKAHQKAVPDCKKCHEKGPGKIEGFGKEMAHGKGCKGCHEEMKKGPTKCGECHKK 91 SCOP domains ----------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------- Transcript 2mz9 A 1 ADDIVLKAKNGDVKFPHKAHQKAVPDCKKCHEKGPGKIEGFGKEMAHGKGCKGCHEEMKKGPTKCGECHKK 71 10 20 30 40 50 60 70
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2MZ9) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2MZ9) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2MZ9) |
Gene Ontology (4, 4)|
NMR Structure(hide GO term definitions) Chain A (Q8GGK7_GEOSN | Q8GGK7)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|