|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2MPB) |
Sites (0, 0)| (no "Site" information available for 2MPB) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2MPB) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2MPB) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2MPB) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2MPB) |
Exons (0, 0)| (no "Exon" information available for 2MPB) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:145 aligned with G2EA45_9FLAO | G2EA45 from UniProtKB/TrEMBL Length:145 Alignment length:145 10 20 30 40 50 60 70 80 90 100 110 120 130 140 G2EA45_9FLAO 1 MSKIEEFLTAEEEKAIVDAIRDAEKNTSGEIRVHLEKTSEIDVFDRAMDVFHNLKMDNTKLQNGVLIYVAVEDKTFVIYGDKGINDVVSDDFWDTTRNAIQLQFKQGNFKQGLVDGIEKAGMALAKYFPWKKDDIDELPNTISKG 145 SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2mpb A 1 MSKIEEFLTAEEEKAIVDAIRDAEKNTSGEIRVHLEKTSEIDVFDRAMDVFHNLKMDNTKLQNGVLIYVAVEDKTFVIYGDKGINDVVSDDFWDTTRNAIQLQFKQGNFKQGLVDGIEKAGMALAKYFPWKKDDIDELPNTISKG 145 10 20 30 40 50 60 70 80 90 100 110 120 130 140
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2MPB) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2MPB) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2MPB) |
Gene Ontology (1, 1)|
NMR Structure(hide GO term definitions) Chain A (G2EA45_9FLAO | G2EA45)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|