Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  THE ACTINOBACTERIAL TRANSCRIPTION FACTOR RBPA BINDS TO THE PRINCIPAL SIGMA SUBUNIT OF RNA POLYMERASE
 
Authors :  B. Liu, M. Parsy, M. Paget, S. Matthews
Date :  06 Apr 13  (Deposition) - 08 May 13  (Release) - 03 Jul 13  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (10x)
NMR Structure *:  A  (1x)
Keywords :  Mv2050, Mtb, Rnap, Sigma Factor, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Tabib-Salazar, B. Liu, P. Doughty, R. A. Lewis, S. Ghosh, M. L. Parsy P. J. Simpson, K. O'Dwyer, S. J. Matthews, M. S. Paget
The Actinobacterial Transcription Factor Rbpa Binds To The Principal Sigma Subunit Of Rna Polymerase.
Nucleic Acids Res. V. 41 5679 2013
PubMed-ID: 23605043  |  Reference-DOI: 10.1093/NAR/GKT277

(-) Compounds

Molecule 1 - UNCHARACTERIZED PROTEIN MB2076
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Expression System VectorPET-20B
    GeneMB2076
    Organism ScientificMYCOBACTERIUM BOVIS
    Organism Taxid233413
    StrainATCC BAA-935 / AF2122/97

 Structural Features

(-) Chains, Units

  1
NMR Structure (10x)A
NMR Structure * (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2M6P)

(-) Sites  (0, 0)

(no "Site" information available for 2M6P)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2M6P)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2M6P)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2M6P)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2M6P)

(-) Exons   (0, 0)

(no "Exon" information available for 2M6P)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:46
 aligned with RBPA_MYCTU | P9WHJ5 from UniProtKB/Swiss-Prot  Length:111

    Alignment length:46
                                    35        45        55        65      
            RBPA_MYCTU   26 PRQIARYRTDNGEEFEVPFADDAEIPGTWLCRNGMEGTLIEGDLPE 71
               SCOP domains ---------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eeeee..........ee.....eeee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------- PROSITE
                 Transcript ---------------------------------------------- Transcript
                  2m6p A 26 PRQIARYRTDNGEEFEVPFADDAEIPGTWLCRNGMEGTLIEGDLPE 71
                                    35        45        55        65      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2M6P)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2M6P)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2M6P)

(-) Gene Ontology  (4, 4)

NMR Structure(hide GO term definitions)
Chain A   (RBPA_MYCTU | P9WHJ5)
molecular function
    GO:0001000    bacterial-type RNA polymerase core enzyme binding    Interacting selectively and non-covalently with the bacterial-type RNA polymerase core enzyme, typically consisting of two alpha, one beta, one beta prime, and one omega subunit.
biological process
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2m6p)
 
  Sites
(no "Sites" information available for 2m6p)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2m6p)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2m6p
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RBPA_MYCTU | P9WHJ5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RBPA_MYCTU | P9WHJ5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RBPA_MYCTU | P9WHJ52m4v 4x8k

(-) Related Entries Specified in the PDB File

2m6o