|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2M4X) |
Sites (0, 0)| (no "Site" information available for 2M4X) |
SS Bonds (3, 3)
NMR Structure
|
||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2M4X) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2M4X) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2M4X) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:35 aligned with TXH4_HAPSC | P83303 from UniProtKB/Swiss-Prot Length:89 Alignment length:35 62 72 82 TXH4_HAPSC 53 ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI 87 SCOP domains d2m4xa_ A: Huwentoxin-IV SCOP domains CATH domains ----------------------------------- CATH domains Pfam domains ----------------------------------- Pfam domains SAPs(SNPs) ----------------------------------- SAPs(SNPs) PROSITE -HWTX_1 PDB: A:2-31 ---- PROSITE Transcript ----------------------------------- Transcript 2m4x A 1 ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI 35 10 20 30
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2M4X) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2M4X) |
Gene Ontology (4, 4)|
NMR Structure(hide GO term definitions) Chain A (TXH4_HAPSC | P83303)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|