|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2M06) |
Sites (0, 0)| (no "Site" information available for 2M06) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2M06) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2M06) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2M06) |
PROSITE Motifs (2, 2)
NMR Structure (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2M06) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:148 aligned with OMPX_ECOLI | P0A917 from UniProtKB/Swiss-Prot Length:171 Alignment length:148 33 43 53 63 73 83 93 103 113 123 133 143 153 163 OMPX_ECOLI 24 ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF 171 SCOP domains d2m06a_ A: Outer membrane protein X (OMPX) SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------ENT_VIR_O------------------------------------------------------------------------------------------------------------ENT_VIR_O PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2m06 A 1 ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF 148 10 20 30 40 50 60 70 80 90 100 110 120 130 140
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2M06) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2M06) |
Gene Ontology (3, 3)|
NMR Structure(hide GO term definitions) Chain A (OMPX_ECOLI | P0A917)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|