Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF KUNITZ-TYPE NEUROTOXIN LMKKT-1A FROM SCORPION VENOM
 
Authors :  F. Luo, L. Jiang, M. Liu, Z. Chen, Y. Wu
Date :  15 Oct 12  (Deposition) - 13 Nov 13  (Release) - 13 Nov 13  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Scorpion Potassium Channel Toxin, Kunitz-Type Neurotoxin, Toxin (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Z. Chen, F. Luo, J. Feng, W. Yang, D. Zeng, R. Zhao, Z. Cao, M. Liu, W. Li, L. Jiang, Y. Wu
Genomic And Structural Characterization Of Kunitz-Type Peptide Lmktt-1A Highlights Diversity And Evolution Of Scorpion Potassium Channel Toxins.
Plos One V. 8 60201 2013
PubMed-ID: 23573241  |  Reference-DOI: 10.1371/JOURNAL.PONE.0060201

(-) Compounds

Molecule 1 - PROTEASE INHIBITOR LMKTT-1A
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector: PET28A
    Expression System Vector Type: VECTOR
    Organism Common: CHINESE STRIPED BARK SCORPION,VIETNAMESE BROWN SCORPION
    Organism Scientific: LYCHAS MUCRONATUS
    Organism Taxid: 172552
    Synonym: SDPII

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2M01)

(-) Sites  (0, 0)

(no "Site" information available for 2M01)

(-) SS Bonds  (3, 3)

NMR Structure
No.Residues
1A:4 -A:54
2A:29 -A:50
3A:51 -A:59

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2M01)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2M01)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BPTI_KUNITZ_2PS50279 Pancreatic trypsin inhibitor (Kunitz) family profile.VKT21_LYCMC25-75  1A:4-54
NMR Structure * (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BPTI_KUNITZ_2PS50279 Pancreatic trypsin inhibitor (Kunitz) family profile.VKT21_LYCMC25-75  1A:4-54

(-) Exons   (0, 0)

(no "Exon" information available for 2M01)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:59
 aligned with VKT21_LYCMC | P0DJ46 from UniProtKB/Swiss-Prot  Length:80

    Alignment length:59
                                    31        41        51        61        71         
           VKT21_LYCMC   22 KKKCQLPSDVGKGKASFTRYYYNEESGKCETFIYGGVGGNSNNFLTKEDCCRECAQGSC 80
               SCOP domains d2m01a_ A: automated matches                                SCOP domains
               CATH domains ----------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------- Pfam domains
         Sec.struct. author ................eeeeeee....eeeeeee.............hhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---BPTI_KUNITZ_2  PDB: A:4-54 UniProt: 25-75          ----- PROSITE
                 Transcript ----------------------------------------------------------- Transcript
                  2m01 A  1 KKKCQLPSDVGKGKASFTRYYYNEESGKCETFIYGGVGGNSNNFLTKEDCCRECAQGSC 59
                                    10        20        30        40        50
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Small proteins (3458)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2M01)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2M01)

(-) Gene Ontology  (7, 7)

NMR Structure(hide GO term definitions)
Chain A   (VKT21_LYCMC | P0DJ46)
molecular function
    GO:0030414    peptidase inhibitor activity    Stops, prevents or reduces the activity of a peptidase, any enzyme that catalyzes the hydrolysis peptide bonds.
    GO:0004867    serine-type endopeptidase inhibitor activity    Stops, prevents or reduces the activity of serine-type endopeptidases, enzymes that catalyze the hydrolysis of nonterminal peptide bonds in a polypeptide chain; a serine residue (and a histidine residue) are at the active center of the enzyme.
biological process
    GO:0044562    envenomation resulting in negative regulation of voltage-gated potassium channel activity in other organism    A process that begins with venom being forced into an organism by the bite or sting of another organism, and ends with a resultant negative regulation of the activity of a voltage-gated potassium channel in the bitten/stung organism.
    GO:0010951    negative regulation of endopeptidase activity    Any process that decreases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
    GO:0010466    negative regulation of peptidase activity    Any process that stops or reduces the rate of peptidase activity, the hydrolysis of peptide bonds within proteins.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0033644    host cell membrane    Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2m01)
 
  Sites
(no "Sites" information available for 2m01)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2m01)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2m01
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  VKT21_LYCMC | P0DJ46
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  VKT21_LYCMC | P0DJ46
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2M01)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2M01)